KEGG   Homo sapiens (human): 613211Help
Entry
613211            CDS       T01001                                 

Gene name
DEFB134
Definition
(RefSeq) defensin beta 134
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_beta_2
Motif
Other DBs
NCBI-GeneID: 613211
NCBI-ProteinID: NP_001289624
HGNC: 32399
Ensembl: ENSG00000205882
Vega: OTTHUMG00000158718
Pharos: Q4QY38(Tdark)
UniProt: Q4QY38
Position
8p23.1
AA seq 66 aa AA seqDB search
MKPLLVVFVFLFLWDPVLAGINSLSSEMHKKCYKNGICRLECYESEMLVAYCMFQLECCV
KGNPAP
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctctccttgttgtgtttgtctttcttttcctttgggatccagtgctggcaggt
ataaattcattatcatcagaaatgcacaagaaatgctataaaaatggcatctgcagactt
gaatgctatgagagtgaaatgttagttgcctactgtatgtttcagctggagtgctgtgtc
aaaggaaatcctgcaccctga

DBGET integrated database retrieval system