KEGG   Homo sapiens (human): 613212
Entry
613212            CDS       T01001                                 
Symbol
CTXN3, KABE
Name
(RefSeq) cortexin 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Cortexin
Other DBs
NCBI-GeneID: 613212
NCBI-ProteinID: NP_001041717
OMIM: 618746
HGNC: 31110
Ensembl: ENSG00000205279
Pharos: Q4LDR2(Tbio)
UniProt: Q4LDR2
Position
5:127649082..127658630
AA seq 81 aa
MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMP
TSTWADGLEGLEKGQFDHALA
NT seq 246 nt   +upstreamnt  +downstreamnt
atggatggaggacagcccatcccctcatccctagtgccccttgggaacgaatcagcagat
tctagcatgtccctggagcagaaaatgacatttgtttttgtgattctgttgtttattttc
ttgggcattctcattgtccggtgcttccggattcttttggatccatatcgaagcatgcca
acctctacctgggctgatggacttgaaggcctggagaaagggcagttcgaccatgccctt
gcttag

DBGET integrated database retrieval system