KEGG   Homo sapiens (human): 6134Help
Entry
6134              CDS       T01001                                 

Gene name
RPL10, AUTSX5, DXS648, DXS648E, L10, MRXS35, NOV, QM
Definition
(RefSeq) ribosomal protein L10
  KO
K02866  large subunit ribosomal protein L10e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Disease
H02111  Autism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6134 (RPL10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    6134 (RPL10)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    6134 (RPL10)
  Archaea
    6134 (RPL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L16
Motif
Other DBs
NCBI-GeneID: 6134
NCBI-ProteinID: NP_001290553
OMIM: 312173
HGNC: 10298
Ensembl: ENSG00000147403
Vega: OTTHUMG00000033189
Pharos: P27635(Tbio)
UniProt: P27635 X5D2T3
Structure
PDB: 

Position
Xq28
AA seq 214 aa AA seqDB search
MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQL
SSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFG
KPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADE
FEDMVAEKRLIPDGCGVKYIPSRGPLDKWRALHS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgggccgccgccccgcccgttgttaccggtattgtaagaacaagccgtacccaaagtct
cgcttctgccgaggtgtccctgatgccaagattcgcatttttgacctggggcggaaaaag
gcaaaagtggatgagtttccgctttgtggccacatggtgtcagatgaatatgagcagctg
tcctctgaagccctggaggctgcccgaatttgtgccaataagtacatggtaaaaagttgt
ggcaaagatggcttccatatccgggtgcggctccaccccttccacgtcatccgcatcaac
aagatgttgtcctgtgctggggctgacaggctccaaacaggcatgcgaggtgcctttgga
aagccccagggcactgtggccagggttcacattggccaagttatcatgtccatccgcacc
aagctgcagaacaaggagcatgtgattgaggccctgcgcagggccaagttcaagtttcct
ggccgccagaagatccacatctcaaagaagtggggcttcaccaagttcaatgctgatgaa
tttgaagacatggtggctgaaaagcggctcatcccagatggctgtggggtcaagtacatc
cccagtcgtggccctctggacaagtggcgggccctgcactcatga

DBGET integrated database retrieval system