KEGG   Homo sapiens (human): 6150
Entry
6150              CDS       T01001                                 

Gene name
MRPL23, L23MRP, RPL23, RPL23L
Definition
(RefSeq) mitochondrial ribosomal protein L23
  KO
K02892  large subunit ribosomal protein L23
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6150 (MRPL23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    6150 (MRPL23)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    6150 (MRPL23)
  Bacteria
    6150 (MRPL23)
  Archaea
    6150 (MRPL23)
SSDB
Motif
Pfam: Ribosomal_L23
Other DBs
NCBI-GeneID: 6150
NCBI-ProteinID: NP_066957
OMIM: 600789
HGNC: 10322
Ensembl: ENSG00000214026
Vega: OTTHUMG00000012476
Pharos: Q16540(Tdark)
UniProt: Q16540 A0A024RCB2
Structure
PDB: 
5OOM 5OOL 3J7Y

Position
11p15.5
AA seq 153 aa
MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGI
YNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEG
SAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcgcggaatgtggtgtaccccctgtaccggctgggtggcccacaacttcgggtgttc
cgaaccaacttcttcattcagctggtgcggcccggtgtggcccagcccgaggacaccgtg
cagttccggatccccatggaaatgacaagggtggacctcaggaattacctcgagggcatc
tataacgtgcccgtggctgctgtgcggacacgggtgcagcatggctctaacaagagaaga
gatcacagaaacgtgaggatcaagaagccggactacaaggtcgcctacgtgcagctggcc
catggacagaccttcacgttcccagatctgtttcccgagaaagacgagagccctgaaggc
agcgctgccgacgacctctacagcatgctcgaggaggagaggcagcagaggcagagcagc
gacccgcggcggggcggcgtccccagctggttcgggctgtga

DBGET integrated database retrieval system