KEGG   Homo sapiens (human): 6166
Entry
6166              CDS       T01001                                 

Gene name
RPL36AL, RPL36A
Definition
(RefSeq) ribosomal protein L36a like
  KO
K02929  large subunit ribosomal protein L44e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6166 (RPL36AL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    6166 (RPL36AL)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    6166 (RPL36AL)
  Archaea
    6166 (RPL36AL)
SSDB
Motif
Pfam: Ribosomal_L44 SVWC NOB1_Zn_bind
Other DBs
NCBI-GeneID: 6166
NCBI-ProteinID: NP_000992
OMIM: 180469
HGNC: 10346
Ensembl: ENSG00000165502
Vega: OTTHUMG00000152330
Pharos: Q969Q0(Tbio)
UniProt: Q969Q0
Position
14q21.3
AA seq 106 aa
MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKA
KTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF
NT seq 321 nt   +upstreamnt  +downstreamnt
atggtcaacgtacctaaaacccgaagaaccttctgtaagaagtgtggcaagcatcagcct
cacaaagtgacacagtataagaagggcaaggattctttgtatgcccagggaaggaggcgc
tatgatcggaagcagagtggctatggtgggcagacaaagccaattttccggaagaaggct
aagaccacaaagaagattgtgctaaggctggaatgtgttgagcctaactgcagatccaag
aggatgctggccattaagagatgcaagcattttgaactgggaggagataagaagagaaag
ggccaagtgatccagttctaa

DBGET integrated database retrieval system