KEGG   Homo sapiens (human): 6175
Entry
6175              CDS       T01001                                 

Gene name
RPLP0, L10E, LP0, P0, PRLP0, RPP0
Definition
(RefSeq) ribosomal protein lateral stalk subunit P0
  KO
K02941  large subunit ribosomal protein LP0
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6175 (RPLP0)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    6175 (RPLP0)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    6175 (RPLP0)
SSDB
Motif
Pfam: RL10P_insert Ribosomal_L10 Ribosomal_60s
Other DBs
NCBI-GeneID: 6175
NCBI-ProteinID: NP_000993
OMIM: 180510
HGNC: 10371
Ensembl: ENSG00000089157
Vega: OTTHUMG00000169317
Pharos: P05388(Tbio)
UniProt: P05388 A0A024RBS2
Position
12q24.23
AA seq 317 aa
MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTM
MRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE
VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI
SPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHS
IINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAATTAAPAAAAAPAKVEA
KEESEESDEDMGFGLFD
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcccagggaagacagggcgacctggaagtccaactacttccttaagatcatccaacta
ttggatgattatccgaaatgtttcattgtgggagcagacaatgtgggctccaagcagatg
cagcagatccgcatgtcccttcgcgggaaggctgtggtgctgatgggcaagaacaccatg
atgcgcaaggccatccgagggcacctggaaaacaacccagctctggagaaactgctgcct
catatccgggggaatgtgggctttgtgttcaccaaggaggacctcactgagatcagggac
atgttgctggccaataaggtgccagctgctgcccgtgctggtgccattgccccatgtgaa
gtcactgtgccagcccagaacactggtctcgggcccgagaagacctcctttttccaggct
ttaggtatcaccactaaaatctccaggggcaccattgaaatcctgagtgatgtgcagctg
atcaagactggagacaaagtgggagccagcgaagccacgctgctgaacatgctcaacatc
tcccccttctcctttgggctggtcatccagcaggtgttcgacaatggcagcatctacaac
cctgaagtgcttgatatcacagaggaaactctgcattctcgcttcctggagggtgtccgc
aatgttgccagtgtctgtctgcagattggctacccaactgttgcatcagtaccccattct
atcatcaacgggtacaaacgagtcctggccttgtctgtggagacggattacaccttccca
cttgctgaaaaggtcaaggccttcttggctgatccatctgcctttgtggctgctgcccct
gtggctgctgccaccacagctgctcctgctgctgctgcagccccagctaaggttgaagcc
aaggaagagtcggaggagtcggacgaggatatgggatttggtctctttgactaa

DBGET integrated database retrieval system