KEGG   Homo sapiens (human): 6176
Entry
6176              CDS       T01001                                 

Gene name
RPLP1, LP1, P1, RPP1
Definition
(RefSeq) ribosomal protein lateral stalk subunit P1
  KO
K02942  large subunit ribosomal protein LP1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6176 (RPLP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    6176 (RPLP1)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    6176 (RPLP1)
SSDB
Motif
Pfam: Ribosomal_60s DEC-1_N
Other DBs
NCBI-GeneID: 6176
NCBI-ProteinID: NP_000994
OMIM: 180520
HGNC: 10372
Ensembl: ENSG00000137818
Vega: OTTHUMG00000172087
Pharos: P05386(Tbio)
UniProt: P05386 A0A024R608
Structure
PDB: 
4BEH 2LBF

Position
15q23
AA seq 114 aa
MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLI
CNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD
NT seq 345 nt   +upstreamnt  +downstreamnt
atggcctctgtctccgagctcgcctgcatctactcggccctcattctgcacgacgatgag
gtgacagtcacggaggataagatcaatgccctcattaaagcagccggtgtaaatgttgag
cctttttggcctggcttgtttgcaaaggccctggccaacgtcaacattgggagcctcatc
tgcaatgtaggggccggtggacctgctccagcagctggtgctgcaccagcaggaggtcct
gccccctccactgctgctgctccagctgaggagaagaaagtggaagcaaagaaagaagaa
tccgaggagtctgatgatgacatgggctttggtctttttgactaa

DBGET integrated database retrieval system