KEGG   Homo sapiens (human): 6185
Entry
6185              CDS       T01001                                 

Gene name
RPN2, RIBIIR, RPN-II, RPNII, SWP1
Definition
(RefSeq) ribophorin II
  KO
K12667  oligosaccharyltransferase complex subunit delta (ribophorin II)
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00072  N-glycosylation by oligosaccharyltransferase
Network
nt06015  N-Glycan biosynthesis
  Element
N00681  N-Glycan precursor biosynthesis, ALG6 to OST
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    6185 (RPN2)
   00513 Various types of N-glycan biosynthesis
    6185 (RPN2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6185 (RPN2)
SSDB
Motif
Pfam: Ribophorin_II HSM3_N DUF5859
Other DBs
NCBI-GeneID: 6185
NCBI-ProteinID: NP_002942
OMIM: 180490
HGNC: 10382
Ensembl: ENSG00000118705
Vega: OTTHUMG00000032409
Pharos: P04844(Tbio)
UniProt: P04844
Position
20q11.23
AA seq 631 aa
MAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSS
LGAQVPDAKKACTYIRSNLDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDS
SVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSI
VEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAI
FSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPL
TQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFMNVKFSSGYYDFLVEVEGDNRYIA
NTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQL
VDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYT
LYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTV
VSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMF
QTLKYLAILGSVTFLAGNRMLAQQAVKRTAH
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggcgccgccgggttcaagcactgtcttcctgttggccctgacaatcatagccagcacc
tgggctctgacgcccactcactacctcaccaagcatgacgtggagagactaaaagcctcg
ctggatcgccctttcacaaatttggaatctgccttctactccatcgtgggactcagcagc
cttggtgctcaggtgccagatgcaaagaaagcatgtacctacatcagatctaaccttgat
cccagcaatgtggattccctcttctacgctgcccaggccagccaggccctctcaggatgt
gagatctctatttcaaatgagaccaaagatctgcttctggcagctgtcagtgaggactca
tctgttacccagatctaccatgcagttgcagctctaagtggctttggccttcccttggca
tcccaagaagcactcagtgcccttactgctcgtctcagcaaggaggagactgtgctggca
acagtccaggctctgcagacagcatcccacctgtcccagcaggctgacctgaggagcatc
gtggaggagattgaggaccttgttgctcgcctggatgaactcgggggcgtgtatctccag
tttgaagaaggactggaaacaacagcgttatttgtggctgccacctacaagctcatggat
catgtggggactgagccatccattaaggaggatcaggtcatccagctgatgaacgcgatc
ttcagcaagaagaactttgagtccctctccgaagccttcagcgtggcctctgcagctgct
gtgctctcgcataatcgctaccacgtgccagttgtggttgtgcctgagggctctgcttcc
gacactcatgaacaggctatcttgcggttgcaagtcaccaatgttctgtctcagcctctg
actcaggccactgttaaactagaacatgctaaatctgttgcttccagagccactgtcctc
cagaagacatccttcacccctgtaggggatgtttttgaactaaatttcatgaacgtcaaa
ttttccagtggttattatgacttccttgtcgaagttgaaggtgacaaccggtatattgca
aataccgtagagctcagagtcaagatctccactgaagttggcatcacaaatgttgatctt
tccaccgtggataaggatcagagcattgcacccaaaactacccgggtgacatacccagcc
aaagccaagggcacattcatcgcagacagccaccagaacttcgccttgttcttccagctg
gtagatgtgaacactggtgctgaactcactcctcaccagacatttgtccgactccataac
cagaagactggccaggaagtggtgtttgttgccgagccagacaacaagaacgtgtacaag
tttgaactggatacctctgaaagaaagattgaatttgactctgcctctggcacctacact
ctctacttaatcattggagatgccactttgaagaacccaatcctctggaatgtggctgat
gtggtcatcaagttccctgaggaagaagctccctcgactgtcttgtcccagaaccttttc
actccaaaacaggaaattcagcacctgttccgcgagcctgagaagaggccccccaccgtg
gtgtccaatacattcactgccctgatcctctcgccgttgcttctgctcttcgctctgtgg
atccggattggtgccaatgtctccaacttcacttttgctcctagcacgattatatttcac
ctgggacatgctgctatgctgggactcatgtatgtctactggactcagctcaacatgttc
cagaccttgaagtacctggccatcctgggcagtgtgacgtttctggctggcaatcggatg
ctggcccagcaggcagtcaagagaacagcacattag

DBGET integrated database retrieval system