KEGG   Homo sapiens (human): 6192Help
Entry
6192              CDS       T01001                                 

Gene name
RPS4Y1, RPS4Y, S4
Definition
(RefSeq) ribosomal protein S4 Y-linked 1
  KO
K02987  small subunit ribosomal protein S4e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Module
hsa_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    6192 (RPS4Y1)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    6192 (RPS4Y1)
  Archaea
    6192 (RPS4Y1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S4e 40S_S4_C RS4NT KOW S4
Motif
Other DBs
NCBI-GeneID: 6192
NCBI-ProteinID: NP_000999
OMIM: 470000
HGNC: 10425
Ensembl: ENSG00000129824
Vega: OTTHUMG00000036152
Pharos: P22090(Tbio)
UniProt: P22090
Position
Yp11.2
AA seq 263 aa AA seqDB search
MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDE
VKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAK
YKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNL
CMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPR
GKGIRLTVAEERDKRLATKQSSG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcccggggccccaagaagcacttaaagcgtgttgcagcgccgaagcattggatgctt
gacaaactaacgggtgtatttgcacctcgtccatcgacaggtccccacaagctgagggaa
tgtcttcctctgatcgtcttcctcaggaatagactcaagtatgcgttgactggagatgag
gtaaagaagatatgtatgcaacgtttcatcaaaattgatggcaaggttcgagtggatgtc
acataccctgctggattcatggatgtcatcagcatcgagaagacaggtgaacatttccgc
ctggtctatgacaccaagggccgttttgctgttcaccgcatcacagtggaagaggcaaag
tacaagttgtgcaaagtgaggaagattactgtgggagtgaagggaatccctcacctggtg
actcatgatgctcgaaccatccgctacccagatcctgtcatcaaggtgaacgatactgtg
cagattgatttagggactggcaagataatcaactttatcaaatttgatacaggcaatttg
tgtatggtgattggtggagccaacctcggtcgtgttggtgtgatcaccaacagggaaaga
catcctggttcttttgatgtggtgcatgtgaaggatgccaatggcaacagctttgccacg
aggctttccaacatttttgtcattggcaatggcaataaaccttggatttccctgcccagg
ggaaagggcattcgacttactgttgctgaagagagagataagaggctggccaccaaacag
agcagtggctaa

DBGET integrated database retrieval system