KEGG   Homo sapiens (human): 619208
Entry
619208            CDS       T01001                                 
Symbol
FAM229B, C6orf225
Name
(RefSeq) family with sequence similarity 229 member B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: UPF0731
Other DBs
NCBI-GeneID: 619208
NCBI-ProteinID: NP_001028736
HGNC: 33858
Ensembl: ENSG00000203778
Pharos: Q4G0N7(Tdark)
UniProt: Q4G0N7
Position
6:112087591..112102790
AA seq 80 aa
MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPV
TVYATTRKPPAQSSKEMHPK
NT seq 243 nt   +upstreamnt  +downstreamnt
atgccttttcaatttggaacccagccaaggaggtttccagtggaaggaggagattcttca
attgagctggaacctgggctgagctccagtgctgcctgtaatgggaaggagatgtcacca
accaggcaactccggaggtgccctggaagtcattgcctgacaataactgatgttcccgtc
actgtttatgcaacaacgagaaagccacctgcacaaagcagcaaggaaatgcatcctaaa
tag

DBGET integrated database retrieval system