KEGG   Homo sapiens (human): 619373Help
Entry
619373            CDS       T01001                                 

Gene name
MBOAT4, FKSG89, GOAT, OACT4
Definition
(RefSeq) membrane bound O-acyltransferase domain containing 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MBOAT
Motif
Other DBs
NCBI-GeneID: 619373
NCBI-ProteinID: NP_001094386
OMIM: 611940
HGNC: 32311
Ensembl: ENSG00000177669
Vega: OTTHUMG00000163824
Pharos: Q96T53(Tbio)
UniProt: Q96T53
Position
8p12
AA seq 435 aa AA seqDB search
MEWLWLFFLHPISFYQGAAFPFALLFNYLCIMDSFSTRARYLFLLTGGGALAVAAMGSYA
VLVFTPAVCAVALLCSLAPQQVHRWTFCFQMSWQTLCHLGLHYTEYYLHEPPSVRFCITL
SSLMLLTQRVTSLSLDICEGKVKAASGGFRSRSSLSEHVCKALPYFSYLLFFPALLGGSL
CSFQRFQARVQGSSALHPRHSFWALSWRGLQILGLECLNVAVSRVVDAGAGLTDCQQFEC
IYVVWTTAGLFKLTYYSHWILDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRIS
VFSRKWNQSTARWLRRLVFQHSRAWPLLQTFAFSAWWHGLHPGQVFGFVCWAVMVEADYL
IHSFANEFIRSWPMRLFYRTLTWAHTQLIIAYIMLAVEVRSLSSLWLLCNSYNSVFPMVY
CILLLLLAKRKHKCN
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggagtggctttggctgttctttctccatcctatatcgttttaccagggggctgcattt
ccctttgcacttctcttcaattatctctgcatcatggattcattctccactcgtgccagg
tacctctttctcctgactggaggaggtgccctggccgtggctgccatgggttcctacgcc
gtgctcgtcttcacccctgctgtctgcgctgtggctctcctctgttccctggctcctcag
caagtccacaggtggaccttctgctttcagatgagctggcagaccttgtgtcacctaggt
ctgcactacactgagtattatctgcatgagcctccttctgtgaggttctgcatcactctt
tcttctctcatgctcttgacccagagggtcacgtccctctctctggacatttgtgagggg
aaagtgaaggcagcatctggaggcttcaggagcaggagctctttgtctgagcatgtgtgt
aaggcactgccctatttcagctacttgctctttttccctgctctcctgggaggctctctg
tgctccttccagcgatttcaggctcgtgttcaagggtccagtgctttgcatcccagacac
tctttctgggctctgagctggaggggtctgcagattcttggactagaatgcctaaacgtg
gcagtgagcagggtggtggatgcaggagcgggactgactgattgccagcaattcgagtgc
atctatgtcgtgtggaccacagctgggcttttcaagctcacctactactcccactggatc
ctggacgactccctcctccacgcagcgggctttgggcctgagcttggtcagagccctgga
gaggagggatatgtccccgatgcagacatctggaccctggaaagaacccacaggatatct
gtgttctcaagaaagtggaaccaaagcacagctcgatggctccgacggcttgtattccag
cacagcagggcttggccgttgttgcagacatttgccttctctgcctggtggcatggactc
catccaggacaggtgtttggtttcgtttgctgggccgtgatggtggaagctgactacctg
attcactcctttgccaatgagtttatcagatcctggccgatgaggctgttctatagaacc
ctcacctgggcccacacccagttgatcattgcctacatcatgctggctgtggaggtcagg
agtctctcctctctctggttgctctgtaattcgtacaacagtgtctttcccatggtgtac
tgtattctgcttttgctattggcgaagagaaagcacaaatgtaactga

DBGET integrated database retrieval system