KEGG   Homo sapiens (human): 6195Help
Entry
6195              CDS       T01001                                 

Gene name
RPS6KA1, HU-1, MAPKAPK1, MAPKAPK1A, RSK, RSK1, p90Rsk
Definition
(RefSeq) ribosomal protein S6 kinase A1
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04114  Oocyte meiosis
hsa04150  mTOR signaling pathway
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04931  Insulin resistance
hsa05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    6195 (RPS6KA1)
   04150 mTOR signaling pathway
    6195 (RPS6KA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    6195 (RPS6KA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    6195 (RPS6KA1)
  09156 Nervous system
   04720 Long-term potentiation
    6195 (RPS6KA1)
   04722 Neurotrophin signaling pathway
    6195 (RPS6KA1)
  09159 Environmental adaptation
   04714 Thermogenesis
    6195 (RPS6KA1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    6195 (RPS6KA1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    6195 (RPS6KA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6195 (RPS6KA1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6195 (RPS6KA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6195 (RPS6KA1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   6195 (RPS6KA1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     6195 (RPS6KA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal Pkinase_C Haspin_kinase APH YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 6195
NCBI-ProteinID: NP_002944
OMIM: 601684
HGNC: 10430
Ensembl: ENSG00000117676
Vega: OTTHUMG00000004003
Pharos: Q15418(Tchem)
UniProt: Q15418
Structure
PDB: 

Position
1p36.11
AA seq 735 aa AA seqDB search
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPS
HFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVN
HPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS
LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHS
HSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN
PANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTP
KDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVV
KETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYD
DGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSN
ILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL
GILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDP
HQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESS
ILAQRRVRKLPSTTL
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgcccagctcaaggagccctggccgctcatggagctagtgcctctggacccg
gagaatggacagacctcaggggaagaagctggacttcagccgtccaaggatgagggcgtc
ctcaaggagatctccatcacgcaccacgtcaaggctggctctgagaaggctgatccatcc
catttcgagctcctcaaggttctgggccagggatcctttggcaaagtcttcctggtgcgg
aaagtcacccggcctgacagtgggcacctgtatgctatgaaggtgctgaagaaggcaacg
ctgaaagtacgtgaccgcgtccggaccaagatggagagagacatcctggctgatgtaaat
cacccattcgtggtgaagctgcactatgccttccagaccgagggcaagctctatctcatt
ctggacttcctgcgtggtggggacctcttcacccggctctcaaaagaggtgatgttcacg
gaggaggatgtgaagttttacctggctgagctggctctgggcctggatcacctgcacagc
ctgggtatcatttacagagacctcaagcctgagaacatccttctggatgaggagggccac
atcaaactcactgactttggcctgagcaaagaggccattgaccacgagaagaaggcctat
tctttctgcgggacagtggagtacatggcccctgaggtcgtcaaccgccagggccactcc
catagtgcggactggtggtcctatggggtgttgatgtttgagatgctgacgggctccctg
cccttccaggggaaggaccggaaggagaccatgacactgattctgaaggcgaagctaggc
atgccccagtttctgagcactgaagcccagagcctcttgcgggccctgttcaagcggaat
cctgccaaccggctcggctccggccctgatggggcagaggaaatcaagcggcatgtcttc
tactccaccattgactggaataagctataccgtcgtgagatcaagccacccttcaagcca
gcagtggctcagcctgatgacaccttctactttgacaccgagttcacgtcccgcacaccc
aaggattccccaggcatcccccccagcgctggggcccatcagctgttccggggcttcagc
ttcgtggccaccggcctgatggaagacgacggcaagcctcgtgccccgcaggcacccctg
cactcggtggtacagcaactccatgggaagaacctggtttttagtgacggctacgtggta
aaggagacaattggtgtgggctcctactctgagtgcaagcgctgtgtccacaaggccacc
aacatggagtatgctgtcaaggtcattgataagagcaagcgggatccttcagaagagatt
gagattcttctgcggtatggccagcaccccaacatcatcactctgaaagatgtgtatgat
gatggcaaacacgtgtacctggtgacagagctgatgcggggtggggagctgctggacaag
atcctgcggcagaagttcttctcagagcgggaggccagctttgtcctgcacaccattggc
aaaactgtggagtatctgcactcacagggggttgtgcacagggacctgaagcccagcaac
atcctgtatgtggacgagtccgggaatcccgagtgcctgcgcatctgtgactttggtttt
gccaaacagctgcgggctgagaatgggctcctcatgacaccttgctacacagccaacttt
gtggcgcctgaggtgctgaagcgccagggctacgatgaaggctgcgacatctggagcctg
ggcattctgctgtacaccatgctggcaggatatactccatttgccaacggtcccagtgac
acaccagaggaaatcctaacccggatcggcagtgggaagtttaccctcagtgggggaaat
tggaacacagtttcagagacagccaaggacctggtgtccaagatgctacacgtggatccc
caccagcgcctcacagctaagcaggttctgcagcatccatgggtcacccagaaagacaag
cttccccaaagccagctgtcccaccaggacctacagcttgtgaagggagccatggctgcc
acgtactccgcactcaacagctccaagcccaccccccagctgaagcccatcgagtcatcc
atcctggcccagcggcgagtgaggaagttgccatccaccaccctgtga

DBGET integrated database retrieval system