KEGG   Homo sapiens (human): 6198Help
Entry
6198              CDS       T01001                                 

Gene name
RPS6KB1, PS6K, S6K, S6K-beta-1, S6K1, STK14A, p70_S6KA, p70(S6K)-alpha, p70-S6K, p70-alpha
Definition
(RefSeq) ribosomal protein S6 kinase B1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04350  TGF-beta signaling pathway
hsa04371  Apelin signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04931  Insulin resistance
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05231  Choline metabolism in cancer
Network
N00037  FGF-FGFR-PI3K signaling pathway
N00039  PDGF-PDGFR-PI3K signaling pathway
N00042  EGFR-overexpression to PI3K signaling pathway
N00045  KITLG-KIT-PI3K signaling pathway
N00049  Mutation-activated PI3K to PI3K signaling pathway
N00050  Amplified PI3K to PI3K signaling pathway
N00234  IGF2-IGF1R-PI3K signaling pathway
N00236  IGF2-overexpression to PI3K signaling pathway
N00238  IGF1R-overexpression to PI3K signaling pathway
N00253  Amplified ERBB2 to PI3K signaling pathway
N00282  EREG-EGFR-PI3K signaling pathway
N00283  EREG-overexpression to PI3K signaling pathway
N00284  AREG-EGFR-PI3K signaling pathway
N00285  AREG-overexpression to PI3K signaling pathway
N00357  HPV E6 to MTOR signaling pathway
N00385  HCMV gB to PDGFR-PI3K signaling pathway
N00387  HCMV IE1-72/IE2-86 to PI3K signaling pathway
N00388  HCMV UL38 to MTOR signaling pathway
 » show all
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    6198 (RPS6KB1)
   04350 TGF-beta signaling pathway
    6198 (RPS6KB1)
   04371 Apelin signaling pathway
    6198 (RPS6KB1)
   04066 HIF-1 signaling pathway
    6198 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    6198 (RPS6KB1)
   04152 AMPK signaling pathway
    6198 (RPS6KB1)
   04150 mTOR signaling pathway
    6198 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6198 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    6198 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    6198 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    6198 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    6198 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    6198 (RPS6KB1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    6198 (RPS6KB1)
   05231 Choline metabolism in cancer
    6198 (RPS6KB1)
   05205 Proteoglycans in cancer
    6198 (RPS6KB1)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    6198 (RPS6KB1)
   05212 Pancreatic cancer
    6198 (RPS6KB1)
   05225 Hepatocellular carcinoma
    6198 (RPS6KB1)
   05226 Gastric cancer
    6198 (RPS6KB1)
   05221 Acute myeloid leukemia
    6198 (RPS6KB1)
   05224 Breast cancer
    6198 (RPS6KB1)
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    6198 (RPS6KB1)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    6198 (RPS6KB1)
   05163 Human cytomegalovirus infection
    6198 (RPS6KB1)
   05165 Human papillomavirus infection
    6198 (RPS6KB1)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    6198 (RPS6KB1)
   01522 Endocrine resistance
    6198 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6198 (RPS6KB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6198 (RPS6KB1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   6198 (RPS6KB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 6198
NCBI-ProteinID: NP_003152
OMIM: 608938
HGNC: 10436
Ensembl: ENSG00000108443
Vega: OTTHUMG00000150642
Pharos: P23443(Tchem)
UniProt: P23443
Structure
PDB: 

Position
17q23.1
AA seq 525 aa AA seqDB search
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgacgaaggaggcgggacggcttttacccagccccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcatcgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatatttatggaagacactgcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtctgggagctggtcct
ggggacgctggagaagttcaagctcatccattctttagacacattaactgggaagaactt
ctggctcgaaaggtggagcccccctttaaacctctgttgcaatctgaagaggatgtaagt
cagtttgattccaagtttacacgtcagacacctgtcgacagcccagatgactcaactctc
agtgaaagtgccaatcaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcggccagcacagcaaatcctcagacacctgtggaatacccaatggaaacaagtggc
atagagcagatggatgtgacaatgagtggggaagcatcggcaccacttccaatacgacag
ccgaactctgggccatacaaaaaacaagcttttcccatgatctccaaacggccagagcac
ctgcgtatgaatctatga

KEGG   Homo sapiens (human): 6199Help
Entry
6199              CDS       T01001                                 

Gene name
RPS6KB2, KLS, P70-beta, P70-beta-1, P70-beta-2, S6K-beta2, S6K2, S6KB, S6KI(2), S6Kbeta, SRK, STK14B, p70(S6K)-beta, p70S6Kb
Definition
(RefSeq) ribosomal protein S6 kinase B2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04350  TGF-beta signaling pathway
hsa04371  Apelin signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04931  Insulin resistance
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05231  Choline metabolism in cancer
Network
N00037  FGF-FGFR-PI3K signaling pathway
N00039  PDGF-PDGFR-PI3K signaling pathway
N00042  EGFR-overexpression to PI3K signaling pathway
N00045  KITLG-KIT-PI3K signaling pathway
N00049  Mutation-activated PI3K to PI3K signaling pathway
N00050  Amplified PI3K to PI3K signaling pathway
N00234  IGF2-IGF1R-PI3K signaling pathway
N00236  IGF2-overexpression to PI3K signaling pathway
N00238  IGF1R-overexpression to PI3K signaling pathway
N00253  Amplified ERBB2 to PI3K signaling pathway
N00282  EREG-EGFR-PI3K signaling pathway
N00283  EREG-overexpression to PI3K signaling pathway
N00284  AREG-EGFR-PI3K signaling pathway
N00285  AREG-overexpression to PI3K signaling pathway
N00357  HPV E6 to MTOR signaling pathway
N00385  HCMV gB to PDGFR-PI3K signaling pathway
N00387  HCMV IE1-72/IE2-86 to PI3K signaling pathway
N00388  HCMV UL38 to MTOR signaling pathway
 » show all
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    6199 (RPS6KB2)
   04350 TGF-beta signaling pathway
    6199 (RPS6KB2)
   04371 Apelin signaling pathway
    6199 (RPS6KB2)
   04066 HIF-1 signaling pathway
    6199 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    6199 (RPS6KB2)
   04152 AMPK signaling pathway
    6199 (RPS6KB2)
   04150 mTOR signaling pathway
    6199 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6199 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    6199 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    6199 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    6199 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    6199 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    6199 (RPS6KB2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    6199 (RPS6KB2)
   05231 Choline metabolism in cancer
    6199 (RPS6KB2)
   05205 Proteoglycans in cancer
    6199 (RPS6KB2)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    6199 (RPS6KB2)
   05212 Pancreatic cancer
    6199 (RPS6KB2)
   05225 Hepatocellular carcinoma
    6199 (RPS6KB2)
   05226 Gastric cancer
    6199 (RPS6KB2)
   05221 Acute myeloid leukemia
    6199 (RPS6KB2)
   05224 Breast cancer
    6199 (RPS6KB2)
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    6199 (RPS6KB2)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    6199 (RPS6KB2)
   05163 Human cytomegalovirus infection
    6199 (RPS6KB2)
   05165 Human papillomavirus infection
    6199 (RPS6KB2)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    6199 (RPS6KB2)
   01522 Endocrine resistance
    6199 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6199 (RPS6KB2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6199 (RPS6KB2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   6199 (RPS6KB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 6199
NCBI-ProteinID: NP_003943
OMIM: 608939
HGNC: 10437
Ensembl: ENSG00000175634
Vega: OTTHUMG00000167673
Pharos: Q9UBS0(Tbio)
UniProt: Q9UBS0
Position
11q13.2
AA seq 482 aa AA seqDB search
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDT
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRA
PVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKKSKRGRGRP
GR
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgtttgatttggatttggagacggaggaaggcagcgagggcgagggcgag
ccagagctcagccccgcggacgcatgtccccttgccgagttgagggcagctggcctagag
cctgtgggacactatgaagaggtggagctgactgagaccagcgtgaacgttggcccagag
cgcatcgggccccactgctttgagctgctgcgtgtgctgggcaaggggggctatggcaag
gtgttccaggtgcgaaaggtgcaaggcaccaacttgggcaaaatatatgccatgaaagtc
ctaaggaaggccaaaattgtgcgcaatgccaaggacacagcacacacacgggctgagcgg
aacattctagagtcagtgaagcacccctttattgtggaactggcctatgccttccagact
ggtggcaaactctacctcatccttgagtgcctcagtggtggcgagctcttcacgcatctg
gagcgagagggcatcttcctggaagatacggcctgcttctacctggctgagatcacgctg
gccctgggccatctccactcccagggcatcatctaccgggacctcaagcccgagaacatc
atgctcagcagccagggccacatcaaactgaccgactttggactctgcaaggagtctatc
catgagggcgccgtcactcacaccttctgcggcaccattgagtacatggcccctgagatt
ctggtgcgcagtggccacaaccgggctgtggactggtggagcctgggggccctgatgtac
gacatgctcactggatcgccgcccttcaccgcagagaaccggaagaaaaccatggataag
atcatcaggggcaagctggcactgcccccctacctcaccccagatgcccgggaccttgtc
aaaaagtttctgaaacggaatcccagccagcggattgggggtggcccaggggatgctgct
gatgtgcagagacatccctttttccggcacatgaattgggacgaccttctggcctggcgt
gtggacccccctttcaggccctgtctgcagtcagaggaggacgtgagccagtttgatacc
cgcttcacacggcagacgccggtggacagtcctgatgacacagccctcagcgagagtgcc
aaccaggccttcctgggcttcacatacgtggcgccgtctgtcctggacagcatcaaggag
ggcttctccttccagcccaagctgcgctcacccaggcgcctcaacagtagcccccgggcc
cccgtcagccccctcaagttctccccttttgaggggtttcggcccagccccagcctgccg
gagcccacggagctacctctacctccactcctgccaccgccgccgccctcgaccaccgcc
cctctccccatccgtcccccctcagggaccaagaagtccaagaggggccgtgggcgtcca
gggcgctag

DBGET integrated database retrieval system