KEGG   Homo sapiens (human): 623Help
Entry
623               CDS       T01001                                 

Gene name
BDKRB1, B1BKR, B1R, BDKRB2, BKB1R, BKR1, BRADYB1
Definition
(RefSeq) bradykinin receptor B1
  KO
K03915  bradykinin receptor B1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    623 (BDKRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    623 (BDKRB1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    623 (BDKRB1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    623 (BDKRB1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    623 (BDKRB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    623 (BDKRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    623 (BDKRB1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Bradykinin
    623 (BDKRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 623
NCBI-ProteinID: NP_000701
OMIM: 600337
HGNC: 1029
Ensembl: ENSG00000100739
Vega: OTTHUMG00000171412
Pharos: P46663(Tchem)
UniProt: P46663
Position
14q32.2
AA seq 353 aa AA seqDB search
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcctggccccctctagagctccaatcctccaaccagagccagctcttccct
caaaatgctacggcctgtgacaatgctccagaagcctgggacctgctgcacagagtgctg
ccaacatttatcatctccatctgtttcttcggcctcctagggaacctttttgtcctgttg
gtcttcctcctgccccggcggcaactgaacgtggcagaaatctacctggccaacctggca
gcctctgatctggtgtttgtcttgggcttgcccttctgggcagagaatatctggaaccag
tttaactggcctttcggagccctcctctgccgtgtcatcaacggggtcatcaaggccaat
ttgttcatcagcatcttcctggtggtggccatcagccaggaccgctaccgcgtgctggtg
caccctatggccagccggaggcagcagcggcggaggcaggcccgggtcacctgcgtgctc
atctgggttgtggggggcctcttgagcatccccacattcctgctgcgatccatccaagcc
gtcccagatctgaacatcaccgcctgcatcctgctcctcccccatgaggcctggcacttt
gcaaggattgtggagttaaatattctgggtttcctcctaccactggctgcgatcgtcttc
ttcaactaccacatcctggcctccctgcgaacgcgggaggaggtcagcaggacaaggtgc
gggggccgcaaggatagcaagaccacagcgctgatcctcacgctcgtggttgccttcctg
gtctgctgggccccttaccacttctttgccttcctggaattcttattccaggtgcaagca
gtccgaggctgcttttgggaggacttcattgacctgggcctgcaattggccaacttcttt
gccttcactaacagctccctgaatccagtaatttatgtctttgtgggccggctcttcagg
accaaggtctgggaactttataaacaatgcacccctaaaagtcttgctccaatatcttca
tcccataggaaagaaatcttccaacttttctggcggaattaa

DBGET integrated database retrieval system