KEGG   Homo sapiens (human): 6233
Entry
6233              CDS       T01001                                 
Symbol
RPS27A, CEP80, HEL112, S27A, UBA80, UBC, UBCEP1, UBCEP80
Name
(RefSeq) ribosomal protein S27a
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05171  Coronavirus disease - COVID-19
Network
nt06141  Translation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01027  UCHL1-mediated hydrolysis
N01028  Mutation-inactivated UCHL1 to UCHL1-mediated hydrolysis
N01029  26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01317  Translation initiation
N01318  SARS-CoV-2 nsp1 to translation initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6233 (RPS27A)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6233 (RPS27A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    6233 (RPS27A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    6233 (RPS27A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6233 (RPS27A)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    6233 (RPS27A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    6233 (RPS27A)
   05022 Pathways of neurodegeneration - multiple diseases
    6233 (RPS27A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    6233 (RPS27A)
   04121 Ubiquitin system [BR:hsa04121]
    6233 (RPS27A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6233 (RPS27A)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    6233 (RPS27A)
  Archaea
    6233 (RPS27A)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   6233 (RPS27A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   6233 (RPS27A)
  Exosomal proteins of colorectal cancer cells
   6233 (RPS27A)
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Dsc3_N Ubiquitin_5 DUF2604
Other DBs
NCBI-GeneID: 6233
NCBI-ProteinID: NP_001129064
OMIM: 191343
HGNC: 10417
Ensembl: ENSG00000143947
Pharos: P62979(Tbio)
UniProt: P62979 B2RDW1
Structure
Position
2:55231903..55235853
AA seq 156 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcagattttcgtgaaaacccttacggggaagaccatcaccctcgaggttgaaccctcg
gatacgatagaaaatgtaaaggccaagatccaggataaggaaggaattcctcctgatcag
cagagactgatctttgctggcaagcagctggaagatggacgtactttgtctgactacaat
attcaaaaggagtctactcttcatcttgtgttgagacttcgtggtggtgctaagaaaagg
aagaagaagtcttacaccactcccaagaagaataagcacaagagaaagaaggttaagctg
gctgtcctgaaatattataaggtggatgagaatggcaaaattagtcgccttcgtcgagag
tgcccttctgatgaatgtggtgctggggtgtttatggcaagtcactttgacagacattat
tgtggcaaatgttgtctgacttactgtttcaacaaaccagaagacaagtaa

DBGET integrated database retrieval system