KEGG   Homo sapiens (human): 6233
Entry
6233              CDS       T01001                                 

Gene name
RPS27A, CEP80, HEL112, S27A, UBA80, UBC, UBCEP1, UBCEP80
Definition
(RefSeq) ribosomal protein S27a
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa05012  Parkinson disease
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01027  UCHL1-mediated hydrolysis
N01028  Mutation-inactivated UCHL1 to UCHL1-mediated hydrolysis
N01029  26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6233 (RPS27A)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6233 (RPS27A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    6233 (RPS27A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    6233 (RPS27A)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    6233 (RPS27A)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    6233 (RPS27A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    6233 (RPS27A)
   04121 Ubiquitin system [BR:hsa04121]
    6233 (RPS27A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6233 (RPS27A)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    6233 (RPS27A)
  Archaea
    6233 (RPS27A)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   6233 (RPS27A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   6233 (RPS27A)
  Exosomal proteins of colorectal cancer cells
   6233 (RPS27A)
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD DUF2407 Ubiquitin_5
Other DBs
NCBI-GeneID: 6233
NCBI-ProteinID: NP_001129064
OMIM: 191343
HGNC: 10417
Ensembl: ENSG00000143947
Vega: OTTHUMG00000151919
Pharos: P62979(Tbio)
UniProt: P62979 B2RDW1
Structure
PDB: 
5NVG 5GOB 5GOD 4XOF 5W46 3NHE 5NL4 5DK8 1OGW 5V1Y 5KYC 5KYF 4IUM 1XD3 5NLF 4PIH 4PIJ 4UN2 5NLI 5NLJ 4ZPZ 5GOJ 5K9P 5J8P 3BY4 2GBM 5GOI 6FDK 5OXH 2ZCB 2GBN 5KYD 5OXI 5X3N 5EMZ 5AF5 6B7M 5NMC 4I6N 3VUX 3V6C 3PRP 3NS8 6EI1 5GOC 6FGE 6OI4 4K7S 4K7U 4K7W 3N32 6GLC 5ULF 5GO7 3ONS 3K9O 1UBI 1UBQ 3EHV 5X3M 5TXK 5GOK 3EFU 6B7O 5WFI 5L8H 5AF4 3ALB 6ISU 3MHS 6GZS 5CVM 4WZP 4LDT 3H7P 5D0M 3TMP 5ULH 5GOH 4PIG 3VUW 2JF5 5NL5 3HM3 5KYE 5GOG 3VUY 5JBY 2GBK 2G45 5YDR 5V1Z 5WVO 5LRW 4WLR 4IG7 3PHW 2GBR 1S1Q 4FJV 6JB7 6AQR 5JBV 5DFL 3V6E 4RF1 5X3O 3NOB 6OQ1 5IFR 4XOK 2XEW 3A33 2O6V 2IBI 5GO8 5AIU 5XPK 5VZW 4R62 6PGV 4UEL 3ZNH 3PRM 3H7S 2WDT 1NBF 3C0R 5OHK 4BOS 4DHJ 3UGB 3OFI 6ASR 5XDP 5ULK 3AUL 5EYA 3IFW 1TBE 6IF1 5BNB 6FX4 5OHL 3RUL 3PT2 3OJ3 2GMI 5YDK 3I3T 6A6I 5N38 5TUT 3DVG 2OJR 5CAW 5CRA 5D0K 5N2W 6JB6 4BVU 3PTF 3O65 3MTN 3JSV 3DVN 2HTH 1F9J 4MM3 5L8W 6S53 5OHV 5OHP 5LRV 4RF0 3VFK 3KVF 3K9P 3IHP 3KW5 5LRX 4HXD 5JP3 4JQW 3ZLZ 3TBL 6FYH 4XOL 6NJ9 3PHD 2XK5 3N30 3EEC 4S1Z 4BOZ 6EQI 5YIK 4LCD 4DHZ 6DC6 5O44 4WUR 5YIJ 6KIU 5ZBU 5UDH 4DDG 5JTV 5JTJ 5CVN 5AF6 3OJ4 5VNZ 5EDV 5H7S 6O96 6H4H 6G5I 5KHY 2AYO 6NQA 6G5H 6G18 5OHN 4JIO 4UF6 4DDI 4ZUX 5CVO 6NOG 5VO0 5A2Q 6KIV 6KIW 6J99 6G51 5OA3 6G53 6FTX 5GJQ 5KGF 6JMA 4WHV 5A5B 6KOW 6KOX 6K4I 6OQ2 6N13 5ZD0 5YMY 5VZM 5XK4 5XK5 5VEY 5VF0 5XBO 5UJL 5UJN 2NBD 2NBE 2N3U 2N3V 2N3W 2N2K 2N13 2MWS 2MUR 2MSG 2MRO 2MRE 2MOR 2MJB 2MJ5 2RU6 2MCN 2MBQ 2MBO 2MBH 2MBB 2LZ6 2LVO 2LVP 2LVQ 2RSU 2LJ5 2L3Z 2L0T 2L0F 2RR9 2KWV 2KWU 2KTF 2KOX 2KN5 2KLG 2KJH 2KHW 2KDF 2K8B 2K8C 2K6D 2JZZ 2JY6 2Z59 2JRI 2PE9 2PEA 2NR2 2J7Q 2DEN 1ZGU 1YX5 1YX6 2BGF 1XQQ 1Q5W 1G6J 1FXT 1D3Z

Position
2p16.1
AA seq 156 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcagattttcgtgaaaacccttacggggaagaccatcaccctcgaggttgaaccctcg
gatacgatagaaaatgtaaaggccaagatccaggataaggaaggaattcctcctgatcag
cagagactgatctttgctggcaagcagctggaagatggacgtactttgtctgactacaat
attcaaaaggagtctactcttcatcttgtgttgagacttcgtggtggtgctaagaaaagg
aagaagaagtcttacaccactcccaagaagaataagcacaagagaaagaaggttaagctg
gctgtcctgaaatattataaggtggatgagaatggcaaaattagtcgccttcgtcgagag
tgcccttctgatgaatgtggtgctggggtgtttatggcaagtcactttgacagacattat
tgtggcaaatgttgtctgacttactgtttcaacaaaccagaagacaagtaa

KEGG   Homo sapiens (human): 7311
Entry
7311              CDS       T01001                                 

Gene name
UBA52, CEP52, HUBCEP52, L40, RPL40
Definition
(RefSeq) ubiquitin A-52 residue ribosomal protein fusion product 1
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa05012  Parkinson disease
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01027  UCHL1-mediated hydrolysis
N01028  Mutation-inactivated UCHL1 to UCHL1-mediated hydrolysis
N01029  26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    7311 (UBA52)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7311 (UBA52)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    7311 (UBA52)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7311 (UBA52)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7311 (UBA52)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    7311 (UBA52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    7311 (UBA52)
   04121 Ubiquitin system [BR:hsa04121]
    7311 (UBA52)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    7311 (UBA52)
  Archaea
    7311 (UBA52)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   7311 (UBA52)
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 7311
NCBI-ProteinID: NP_001029102
OMIM: 191321
HGNC: 12458
Ensembl: ENSG00000221983
Vega: OTTHUMG00000183110
Pharos: P62987(Tbio)
UniProt: P62987 Q3MIH3 Q7Z4P3
Structure
PDB: 
5NVG 5GOB 5GOD 4XOF 5W46 3NHE 5NL4 5DK8 1OGW 5V1Y 5KYC 5KYF 4IUM 1XD3 5NLF 4PIH 4PIJ 4UN2 5NLI 5NLJ 4ZPZ 5GOJ 5K9P 5J8P 3BY4 2GBM 5GOI 6FDK 5OXH 2ZCB 2GBN 5KYD 5OXI 5X3N 5EMZ 5AF5 6B7M 5NMC 4I6N 3VUX 3V6C 3PRP 3NS8 6EI1 5GOC 6FGE 6OI4 4K7S 4K7U 4K7W 3N32 6GLC 5ULF 5GO7 3ONS 1UBI 1UBQ 3EHV 5X3M 5TXK 5GOK 3EFU 6B7O 5WFI 5L8H 5AF4 3ALB 6ISU 3MHS 6GZS 5CVM 4WZP 4LDT 3H7P 5D0M 3TMP 5ULH 5GOH 4PIG 3VUW 2JF5 5NL5 3HM3 5KYE 5GOG 3VUY 5JBY 2GBK 2G45 5YDR 5V1Z 5WVO 5LRW 4WLR 4IG7 3PHW 2GBR 1S1Q 4FJV 6JB7 6AQR 5JBV 5DFL 3V6E 4RF1 5X3O 3NOB 6OQ1 5IFR 4XOK 2XEW 3A33 2O6V 2IBI 5GO8 5AIU 5XPK 5VZW 4R62 6PGV 4UEL 3ZNH 3PRM 3H7S 2WDT 1NBF 3C0R 5OHK 4BOS 4DHJ 3UGB 3OFI 6ASR 5XDP 5ULK 3AUL 5EYA 3IFW 1TBE 6IF1 5BNB 6FX4 5OHL 3RUL 3PT2 3OJ3 2GMI 5YDK 3I3T 6A6I 5N38 5TUT 3DVG 2OJR 5CAW 5CRA 5D0K 5N2W 6JB6 4BVU 3PTF 3O65 3MTN 3JSV 3DVN 2HTH 1F9J 4MM3 5L8W 6S53 5OHV 5OHP 5LRV 4RF0 3VFK 3KVF 3K9P 3IHP 3KW5 5LRX 4HXD 5JP3 4JQW 3ZLZ 3TBL 6FYH 4XOL 6NJ9 3PHD 2XK5 3N30 3EEC 4S1Z 4BOZ 6EQI 5YIK 4LCD 4DHZ 6DC6 5O44 4WUR 5YIJ 6KIU 5ZBU 5UDH 4DDG 5JTV 5JTJ 5CVN 5AF6 3OJ4 5VNZ 5EDV 5H7S 6O96 6H4H 5KHY 2AYO 6NQA 5OHN 4JIO 4UF6 4DDI 4ZUX 5CVO 6NOG 5VO0 6KIV 6KIW 6J99 6FTX 5GJQ 5KGF 6JMA 4WHV 5A5B 6KOW 6KOX 6K4I 6OQ2 6N13 5ZD0 5YMY 5VZM 5XK4 5XK5 5VEY 5VF0 5XBO 5UJL 5UJN 2NBD 2NBE 2N3U 2N3V 2N3W 2N2K 2N13 2MWS 2MUR 2MSG 2MRO 2MRE 2MOR 2MJB 2MJ5 2RU6 2MCN 2MBQ 2MBO 2MBH 2MBB 2LZ6 2LVO 2LVP 2LVQ 2RSU 2LJ5 2L3Z 2L0T 2L0F 2RR9 2KWV 2KWU 2KTF 2KOX 2KN5 2KLG 2KJH 2KHW 2KDF 2K8B 2K8C 2K6D 2JZZ 2JY6 2Z59 2JRI 2PE9 2PEA 2NR2 2J7Q 2DEN 1ZGU 1YX5 1YX6 2BGF 1XQQ 1Q5W 1G6J 1FXT 1D3Z

Position
19p13.11
AA seq 128 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcagatctttgtgaagaccctcactggcaaaaccatcacccttgaggtcgagcccagt
gacaccattgagaatgtcaaagccaaaattcaagacaaggagggtatcccacctgaccag
cagcgtctgatatttgccggcaaacagctggaggatggccgcactctctcagactacaac
atccagaaagagtccaccctgcacctggtgttgcgcctgcgaggtggcattattgagcct
tctctccgccagcttgcccagaaatacaactgcgacaagatgatctgccgcaagtgctat
gctcgccttcaccctcgtgctgtcaactgccgcaagaagaagtgtggtcacaccaacaac
ctgcgtcccaagaagaaggtcaaataa

KEGG   Homo sapiens (human): 7314
Entry
7314              CDS       T01001                                 

Gene name
UBB, HEL-S-50
Definition
(RefSeq) ubiquitin B
  KO
K04551  ubiquitin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa05012  Parkinson disease
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01027  UCHL1-mediated hydrolysis
N01028  Mutation-inactivated UCHL1 to UCHL1-mediated hydrolysis
N01029  26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7314 (UBB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    7314 (UBB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7314 (UBB)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7314 (UBB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    7314 (UBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7314 (UBB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7314 (UBB)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   7314 (UBB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   7314 (UBB)
  Exosomal proteins of other body fluids (saliva and urine)
   7314 (UBB)
  Exosomal proteins of colorectal cancer cells
   7314 (UBB)
  Exosomal proteins of bladder cancer cells
   7314 (UBB)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 7314
NCBI-ProteinID: NP_001268645
OMIM: 191339
HGNC: 12463
Ensembl: ENSG00000170315
Vega: OTTHUMG00000058987
Pharos: P0CG47(Tbio)
UniProt: P0CG47 Q5U5U6
Structure
PDB: 
5NVG 5GOB 5GOD 4XOF 5W46 3NHE 5NL4 5DK8 1OGW 5V1Y 5KYC 5KYF 4IUM 1XD3 5YT6 5NLF 4PIH 4PIJ 4UN2 5NLI 5NLJ 4V3L 4ZPZ 5GOJ 5K9P 5J8P 3BY4 2GBM 5GOI 6FDK 5OXH 2ZCB 2GBN 5KYD 5OXI 4K1R 6HEI 5X3N 5EMZ 5AF5 6HPR 6B7M 5NMC 4I6N 3VUX 3V6C 3B08 3PRP 3NS8 4ZFR 6EI1 5GOC 6FGE 4MSM 6OI4 4K7S 4K7U 4K7W 5M93 3N32 6GLC 5ULF 5GO7 4ZQS 3ONS 3K9O 1UBI 1UBQ 3EHV 5X3M 5TXK 5GOK 3EFU 6B7O 5WFI 5L8H 5AF4 3ALB 6ISU 3MHS 6GZS 5CVM 4WZP 4LDT 3ZNZ 3B0A 3H7P 5D0M 3TMP 6N6R 5ULH 5GOH 4PIG 4MSQ 3VUW 2JF5 5NL5 3HM3 5KYE 5GOG 3VUY 5JBY 2GBK 2G45 5YDR 5V1Z 5WVO 5LRW 4WLR 4IG7 3PHW 2GBR 1S1Q 4V3K 6NJD 4PQT 4FJV 6JB7 6AQR 5JBV 5DFL 4XKL 3V6E 4RF1 5MNJ 5ZQ3 4AUQ 5X3O 3AXC 3NOB 6OQ1 5IFR 4XOK 2XEW 3A33 2O6V 2IBI 5GO8 5AIU 3ZNI 4AP4 5ZQ4 6QK9 2W9N 5XPK 5VZW 4R62 6PGV 4ZFT 4UEL 3WXF 3ZNH 3PRM 3H7S 2WDT 1NBF 3C0R 5OHK 4BOS 4DHJ 3UGB 3OFI 6ASR 5XDP 5ULK 3AUL 5EYA 4KSK 3IFW 1TBE 3U30 6IF1 5ZQ5 5BNB 6FX4 5OHL 3WXE 3RUL 3PT2 3OJ3 2GMI 5YDK 5H07 3I3T 6A6I 5N38 5TUT 3DVG 2OJR 4MDK 5CAW 5CRA 5D0K 5N2W 6JB6 4BVU 2Y5B 3PTF 3O65 3MTN 3JSV 3DVN 2HTH 1F9J 4MM3 5L8W 6S53 5OHV 5OHP 5LRV 4RF0 3VFK 3KVF 3K9P 3IHP 4KSL 3KW5 5ZQ7 5LRX 4HXD 6CP2 5JP3 4JQW 3ZLZ 3TBL 2ZVO 6FYH 4XOL 5OE7 6NJ9 5WQ4 3PHD 2XK5 3N30 2ZVN 3EEC 5ZQ6 6HEK 4S1Z 4BOZ 6EQI 5YIK 4LCD 3JW0 4DHZ 6DC6 5O44 5LN1 4WUR 5YIJ 6KIU 5ZBU 5UDH 4DDG 3JVZ 5JTV 5JTJ 5CVN 5AF6 4P4H 3OJ4 5VNZ 5EDV 5H7S 6O96 6H4H 5KHY 2AYO 6NQA 5OHN 4JIO 4UF6 4NQK 4DDI 4ZUX 5CVO 6NOG 6NN6 5VO0 6KIV 6KIW 6J99 6FTX 5GJQ 5KGF 6JMA 4WHV 5A5B 6KOW 6KOX 6K4I 6OQ2 6QF8 6N13 5ZD0 5YMY 5VZM 5XK4 5XK5 5VEY 5VF0 5XBO 5UJL 5UJN 2NBD 2NBE 2N3U 2N3V 2N3W 2N2K 2N13 2MWS 2MUR 2MSG 2MRO 2MRE 2MOR 2MJB 2MJ5 2RU6 2MCN 2MBQ 2MBO 2MBH 2MBB 2LZ6 2LVO 2LVP 2LVQ 2RSU 2LJ5 2LD9 2L3Z 2L0T 2L0F 2RR9 2KX0 2KWV 2KWU 2KTF 2KOX 2KN5 2KLG 2KJH 2KHW 2KDF 2K8B 2K8C 2K6D 2K25 2JZZ 2JY6 2Z59 2JRI 2PE9 2PEA 2NR2 2J7Q 2DEN 1ZGU 1YX5 1YX6 2BGF 1XQQ 1Q5W 1GJZ 1G6J 1FXT 1D3Z

Position
17p11.2
AA seq 229 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaaaacccttaccggcaagaccatcacccttgaggtggagcccagt
gacaccatcgaaaatgtgaaggccaagatccaggataaggaaggcattccccccgaccag
cagaggctcatctttgcaggcaagcagctggaagatggccgtactctttctgactacaac
atccagaaggagtcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttc
gtgaagaccctgaccggcaagaccatcaccctggaagtggagcccagtgacaccatcgaa
aatgtgaaggccaagatccaggataaagaaggcatccctcccgaccagcagaggctcatc
tttgcaggcaagcagctggaagatggccgcactctttctgactacaacatccagaaggag
tcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttcgtgaagaccctg
accggcaagaccatcactctggaggtggagcccagtgacaccatcgaaaatgtgaaggcc
aagatccaagataaagaaggcatcccccccgaccagcagaggctcatctttgcaggcaag
cagctggaagatggccgcactctttctgactacaacatccagaaagagtcgaccctgcac
ctggtcctgcgcctgaggggtggctgttaa

KEGG   Homo sapiens (human): 7316
Entry
7316              CDS       T01001                                 

Gene name
UBC, HMG20
Definition
(RefSeq) ubiquitin C
  KO
K08770  ubiquitin C
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa05012  Parkinson disease
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01027  UCHL1-mediated hydrolysis
N01028  Mutation-inactivated UCHL1 to UCHL1-mediated hydrolysis
N01029  26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7316 (UBC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    7316 (UBC)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    7316 (UBC)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7316 (UBC)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7316 (UBC)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    7316 (UBC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7316 (UBC)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   7316 (UBC)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5
Other DBs
NCBI-GeneID: 7316
NCBI-ProteinID: NP_066289
OMIM: 191340
HGNC: 12468
Ensembl: ENSG00000150991
Vega: OTTHUMG00000044421
Pharos: P0CG48(Tbio)
UniProt: P0CG48
Structure
PDB: 
5NVG 5GOB 5GOD 4XOF 5W46 3NHE 5NL4 5DK8 1OGW 2GBJ 5V1Y 5KYC 5KYF 4IUM 1XD3 5YT6 5NLF 4PIH 4PIJ 4UN2 5NLI 5NLJ 4V3L 4ZPZ 5GOJ 5K9P 5J8P 3BY4 2GBM 5GOI 6FDK 5OXH 2ZCB 2GBN 5KYD 5OXI 4K1R 6HEI 5X3N 5EMZ 5AF5 6HPR 6B7M 5NMC 4I6N 3VUX 3V6C 3B08 3PRP 3NS8 4ZFR 6EI1 5GOC 6FGE 4MSM 6OI4 4K7S 4K7U 4K7W 5M93 3N32 6GLC 5ULF 5GO7 4ZQS 3ONS 3K9O 1UBI 1UBQ 3EHV 5X3M 5TXK 5GOK 3EFU 6B7O 5WFI 5L8H 5AF4 3ALB 6ISU 3MHS 6GZS 5CVM 4WZP 4LDT 3ZNZ 3B0A 3H7P 5D0M 3TMP 6N6R 5ULH 5GOH 4PIG 4MSQ 3VUW 2JF5 5NL5 3HM3 5KYE 5GOG 3VUY 5JBY 2GBK 2G45 5YDR 5V1Z 5WVO 5LRW 4WLR 4IG7 3PHW 2GBR 1S1Q 4V3K 6NJD 4PQT 4FJV 6JB7 6AQR 5JBV 5DFL 4XKL 3V6E 4RF1 5MNJ 5ZQ3 4AUQ 5X3O 3AXC 3NOB 6OQ1 5IFR 4XOK 2XEW 3A33 2O6V 2IBI 5GO8 5AIU 3ZNI 4AP4 5ZQ4 6QK9 2W9N 5XPK 5VZW 4R62 6PGV 4ZFT 4UEL 3WXF 3ZNH 3PRM 3H7S 2WDT 1NBF 3C0R 5OHK 4BOS 4DHJ 3UGB 3OFI 6ASR 5XDP 5ULK 3AUL 5EYA 4KSK 3IFW 1TBE 3U30 6IF1 5ZQ5 5BNB 6FX4 5OHL 3WXE 3RUL 3PT2 3OJ3 2GMI 5YDK 5H07 3I3T 6A6I 5N38 5TUT 3DVG 2OJR 4MDK 5CAW 5CRA 5D0K 5N2W 5B83 6JB6 4BVU 2Y5B 3PTF 3O65 3MTN 3JSV 3DVN 2HTH 1F9J 4MM3 5L8W 6S53 5OHV 5OHP 5LRV 4RF0 3VFK 3KVF 3K9P 3IHP 4KSL 3KW5 5ZQ7 5LRX 4HXD 6CP2 5JP3 4JQW 3ZLZ 3TBL 2ZVO 6FYH 4XOL 5OE7 6NJ9 5WQ4 3PHD 2XK5 3N30 2ZVN 3EEC 5ZQ6 6HEK 4S1Z 4BOZ 6EQI 5YIK 4LCD 3JW0 4DHZ 6DC6 5O44 5LN1 4WUR 5YIJ 6KIU 5ZBU 5UDH 4DDG 3JVZ 5JTV 5JTJ 5CVN 5AF6 4P4H 3OJ4 5VNZ 5EDV 5H7S 6O96 6H4H 5KHY 2AYO 6NQA 5OHN 4JIO 4UF6 4NQK 5OHM 4DDI 4ZUX 5CVO 6NOG 6NN6 5VO0 6KIV 6KIW 6J99 6FTX 5GJQ 5KGF 6JMA 4WHV 5A5B 6KOW 6KOX 6K4I 6OQ2 6QF8 6N13 5ZD0 5YMY 5VZM 5XK4 5XK5 5VEY 5VF0 5XBO 5UJL 5UJN 2NBD 2NBE 2N3U 2N3V 2N3W 2N2K 2N13 2MWS 2MUR 2MSG 2MRO 2MRE 2MOR 2MJB 2MJ5 2RU6 2MCN 2MBQ 2MBO 2MBH 2MBB 2LZ6 2LVO 2LVP 2LVQ 2RSU 2LJ5 2LD9 2L3Z 2L0T 2L0F 2RR9 2KX0 2KWV 2KWU 2KTF 2KOX 2KN5 2KLG 2KJH 2KHW 2KDF 2K8B 2K8C 2K6D 2K25 2JZZ 2JY6 2Z59 2JRI 2PE9 2PEA 2NR2 2J7Q 2DEN 1ZGU 1YX5 1YX6 2BGF 1XQQ 1Q5W 1GJZ 1G6J 1FXT 1D3Z

Position
12q24.31
AA seq 685 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
GRTLSDYNIQKESTLHLVLRLRGGV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagactctgactggtaagaccatcaccctcgaggttgagcccagt
gacaccatcgagaatgtcaaggcaaagatccaagataaggaaggcatccctcctgaccag
cagaggctgatctttgctggaaaacagctggaagatgggcgcaccctgtctgactacaac
atccagaaagagtccaccctgcacctggtgctccgtctcagaggtgggatgcaaatcttc
gtgaagacactcactggcaagaccatcacccttgaggtcgagcccagtgacaccatcgag
aacgtcaaagcaaagatccaggacaaggaaggcattcctcctgaccagcagaggttgatc
tttgccggaaagcagctggaagatgggcgcaccctgtctgactacaacatccagaaagag
tctaccctgcacctggtgctccgtctcagaggtgggatgcagatcttcgtgaagaccctg
actggtaagaccatcaccctcgaggtggagcccagtgacaccatcgagaatgtcaaggca
aagatccaagataaggaaggcattcctcctgatcagcagaggttgatctttgccggaaaa
cagctggaagatggtcgtaccctgtctgactacaacatccagaaagagtccaccttgcac
ctggtactccgtctcagaggtgggatgcaaatcttcgtgaagacactcactggcaagacc
atcacccttgaggtcgagcccagtgacactatcgagaacgtcaaagcaaagatccaagac
aaggaaggcattcctcctgaccagcagaggttgatctttgccggaaagcagctggaagat
gggcgcaccctgtctgactacaacatccagaaagagtctaccctgcacctggtgctccgt
ctcagaggtgggatgcagatcttcgtgaagaccctgactggtaagaccatcactctcgaa
gtggagccgagtgacaccattgagaatgtcaaggcaaagatccaagacaaggaaggcatc
cctcctgaccagcagaggttgatctttgccggaaaacagctggaagatggtcgtaccctg
tctgactacaacatccagaaagagtccaccttgcacctggtgctccgtctcagaggtggg
atgcagatcttcgtgaagaccctgactggtaagaccatcactctcgaggtggagccgagt
gacaccattgagaatgtcaaggcaaagatccaagacaaggaaggcatccctcctgaccag
cagaggttgatctttgctgggaaacagctggaagatggacgcaccctgtctgactacaac
atccagaaagagtccaccctgcacctggtgctccgtcttagaggtgggatgcagatcttc
gtgaagaccctgactggtaagaccatcactctcgaagtggagccgagtgacaccattgag
aatgtcaaggcaaagatccaagacaaggaaggcatccctcctgaccagcagaggttgatc
tttgctgggaaacagctggaagatggacgcaccctgtctgactacaacatccagaaagag
tccaccctgcacctggtgctccgtcttagaggtgggatgcagatcttcgtgaagaccctg
actggtaagaccatcactctcgaagtggagccgagtgacaccattgagaatgtcaaggca
aagatccaagacaaggaaggcatccctcctgaccagcagaggttgatctttgctgggaaa
cagctggaagatggacgcaccctgtctgactacaacatccagaaagagtccaccctgcac
ctggtgctccgtctcagaggtgggatgcaaatcttcgtgaagaccctgactggtaagacc
atcaccctcgaggtggagcccagtgacaccatcgagaatgtcaaggcaaagatccaagat
aaggaaggcatccctcctgatcagcagaggttgatctttgctgggaaacagctggaagat
ggacgcaccctgtctgactacaacatccagaaagagtccactctgcacttggtcctgcgc
ttgagggggggtgtctaa

DBGET integrated database retrieval system