KEGG   Homo sapiens (human): 6236
Entry
6236              CDS       T01001                                 
Symbol
RRAD, RAD, RAD1, REM3
Name
(RefSeq) RRAD, Ras related glycolysis inhibitor and calcium channel regulator
  KO
K07845  Ras-related associated with diabetes
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    6236 (RRAD)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Ras Family
   Rad/Gem/Kir [OT]
    6236 (RRAD)
SSDB
Motif
Pfam: Ras Roc AAA_16 FeoB_N Arf AAA RuvB_N AAA_5 MMR_HSR1
Other DBs
NCBI-GeneID: 6236
NCBI-ProteinID: NP_001122322
OMIM: 179503
HGNC: 10446
Ensembl: ENSG00000166592
Pharos: P55042(Tbio)
UniProt: P55042 A0A024R6X0
Structure
Position
16:complement(66921685..66925535)
AA seq 308 aa
MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAA
AGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEA
EAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKA
SELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNV
QALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSK
SCHDLSVL
NT seq 927 nt   +upstreamnt  +downstreamnt
atgaccctgaacggcggcggcagcggagcgggcgggagccgcggtgggggccaggagcgc
gagcgccgtcggggcagcacaccctggggccccgccccgccgctgcaccgccgcagcatg
ccggtggacgagcgcgacctgcaggcggcgctgaccccgggtgccctgacggcggccgcg
gccgggacggggacccagggtcccaggctggactggcccgaggactccgaggactcgctc
agctcagggggcagcgactcagacgagagcgtttacaaggtgctgctgctgggggcgccc
ggcgtgggcaagagcgccctggcgcgcatcttcggcggtgtggaggacgggcctgaagca
gaggcagcagggcacacctatgatcgctccattgtagtggacggagaagaggcatcactc
atggtctacgacatttgggagcaggacgggggccgctggttgcccggccactgcatggcc
atgggggatgcctatgtcattgtgtactcagtgacggacaagggcagcttcgagaaggcc
tcagaactgcgggtccagctgcggcgtgcacggcaaacagatgatgtgcccatcatcctc
gtgggcaacaagagcgacctggtgcgctctcgtgaggtctcggtggatgagggccgggcc
tgcgcggtggtctttgactgcaagttcattgagacatcagcggcattgcaccacaatgtc
caggcgctgtttgaaggtgtcgtgcgccagatacgcctgcgcagggacagcaaagaagcc
aacgcacgacggcaagcaggcacccggaggcgagagagccttggcaaaaaggcgaagcgc
ttcttgggccgcatcgtagctcgtaacagccgcaagatggcctttcgcgccaaatccaag
tcctgccacgacctctcggttctctag

DBGET integrated database retrieval system