KEGG   Homo sapiens (human): 6237Help
Entry
6237              CDS       T01001                                 

Gene name
RRAS, R-Ras
Definition
(RefSeq) RAS related
  KO
K07829  Ras-related protein R-Ras
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04218  Cellular senescence
hsa04360  Axon guidance
hsa04371  Apelin signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    6237 (RRAS)
   04015 Rap1 signaling pathway
    6237 (RRAS)
   04010 MAPK signaling pathway
    6237 (RRAS)
   04371 Apelin signaling pathway
    6237 (RRAS)
   04072 Phospholipase D signaling pathway
    6237 (RRAS)
   04024 cAMP signaling pathway
    6237 (RRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6237 (RRAS)
   04137 Mitophagy - animal
    6237 (RRAS)
  09143 Cell growth and death
   04218 Cellular senescence
    6237 (RRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    6237 (RRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    6237 (RRAS)
  09158 Development and regeneration
   04360 Axon guidance
    6237 (RRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    6237 (RRAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    6237 (RRAS)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    6237 (RRAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 AAA_22
Motif
Other DBs
NCBI-GeneID: 6237
NCBI-ProteinID: NP_006261
OMIM: 165090
HGNC: 10447
Ensembl: ENSG00000126458
Vega: OTTHUMG00000183247
Pharos: P10301(Tbio)
UniProt: P10301 A0A024QZF2
Structure
PDB: 

Position
19q13.33
AA seq 218 aa AA seqDB search
MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP
TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG
KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD
EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcgggggacctggg
cccggggaccccccgcccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg
ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc
actattgaggactcctacacgaagatctgcagtgtggatggcatcccagcccggctggac
atcctggacaccgcgggccaggaagagttcggggccatgagagagcagtacatgcgtgct
ggccacggcttcctgctggtgttcgccattaacgaccggcagagtttcaacgaggtgggc
aagctcttcacgcagattctgcgggtcaaggaccgcgacgacttccccgttgtgttggtc
gggaacaaggcagatctggagtcacagcgccaggtcccccgatcagaagcctctgccttc
ggcgcctcccaccacgtggcctactttgaggcctcggccaaactgcgtctcaacgtggac
gaggcttttgagcagctggtgcgggctgtccggaaataccaggaacaagagctcccaccg
agccctcccagtgcccccaggaagaagggcgggggctgcccctgcgtcctcctgtag

DBGET integrated database retrieval system