KEGG   Homo sapiens (human): 6238
Entry
6238              CDS       T01001                                 

Symbol
RRBP1, ES/130, ES130, RRp, hES, p180
Name
(RefSeq) ribosome binding protein 1
  KO
K14000  ribosome-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6238 (RRBP1)
SSDB
Motif
Pfam: Rib_recp_KP_reg NTP_transf_3 ABC_export
Other DBs
NCBI-GeneID: 6238
NCBI-ProteinID: NP_001036041
OMIM: 601418
HGNC: 10448
Ensembl: ENSG00000125844
Vega: OTTHUMG00000031945
Pharos: Q9P2E9(Tbio)
UniProt: Q9P2E9
Position
20p12.1
AA seq 977 aa
MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKVEKK
KKEKTVEKKGKTKKKEEKPNGKIPDHDPAPNVTVLLREPVRAPAVAVAPTPVQPPIIVAP
VATVPAMPQEKLASSPKDKKKKEKKVAKVEPAVSSVVNSIQVLTSKAAILETAPKEGRNT
DVAQSPEAPKQEAPAKKKSGSKKKGPPDADGPLYLPYKTLVSTVGSMVFNEGEAQRLIEI
LSEKAGIIQDTWHKATQKGDPVAILKRQLEEKEKLLATEQEDAAVAKSKLRELNKEMAAE
KAKAAAGEAKVKKQLVAREQEITAVQARMQASYREHVKEVQQLQGKIRTLQEQLENGPNT
QLARLQQENSILRDALNQATSQVESKQNAELAKLRQELSKVSKELVEKSEAVRQDEQQRK
ALEAKAAAFEKQVLQLQASHRESEEALQKRLDEVSRELCHTQSSHASLRADAEKAQEQQQ
QMAELHSKLQSSEAEVRSKCEELSGLHGQLQEARAENSQLTERIRSIEALLEAGQARDAQ
DVQASQAEADQQQTRLKELESQVSGLEKEAIELREAVEQQKVKNNDLREKNWKAMEALAT
AEQACKEKLLSLTQAKEESEKQLCLIEAQTMEALLALLPELSVLAQQNYTEWLQDLKEKG
PTLLKHPPAPAEPSSDLASKLREAEETQSTLQAECDQYRSILAETEGMLRDLQKSVEEEE
QVWRAKVGAAEEELQKSRVTVKHLEEIVEKLKGELESSDQVREHTSHLEAELEKHMAAAS
AECQNYAKEVAGLRQLLLESQSQLDAAKSEAQKQSDELALVRQQLSEMKSHVEDGDIAGA
PASSPEAPPAEQDPVQLKTQLEWTEAILEDEQTQRQKLTAEFEEAQTSACRLQEELEKLR
TAGPLESSETEEASQLKERLEKEKKLTSDLGRAATRLQELLKTTQEQLAREKDTVKKLQE
QLEKAEDGSSSKEGTSV
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggatatttacgacactcaaaccttgggggttgtggtctttggaggattcatggttgtt
tctgccattggcatcttcctggtgtcgactttctccatgaaggaaacgtcatatgaagaa
gccctagccaaccagcgcaaggagatggcgaaaactcaccaccagaaagtcgagaagaaa
aagaaggagaaaacagtggagaagaaaggaaagaccaagaaaaaggaagagaaacctaat
gggaagatacctgatcatgatccagcccccaatgtgactgtcctccttcgagaaccagtg
cgggctcctgctgtggctgtggctccaaccccagtgcagccccccattatcgttgctcct
gtcgccacagttccagccatgccccaggagaagctggcctcctcccccaaggacaaaaag
aagaaggagaaaaaagtggcaaaagtggaaccagctgtcagctctgtagtgaattccatc
caggttctcacttcgaaggctgccatcttggaaactgctcccaaggagggcagaaataca
gatgtggcccagagcccagaggcaccaaagcaagaggctcctgccaagaagaagtctggt
tcaaagaaaaaagggcccccagatgccgacggccctctctacctcccctacaagacgctg
gtctccacggttgggagcatggtgttcaacgagggcgaggcccagcggctcatcgagatc
ctgtctgagaaggctggcatcattcaggacacctggcacaaggccactcagaagggtgac
cctgtggcgattctgaaacgccagctggaagagaaggaaaaactgctggccacagaacag
gaagatgcggctgtcgccaagagcaaactgagggagctcaacaaggagatggcagcagaa
aaggccaaagcagcagccggggaggccaaagtgaaaaagcagctggtggcccgggagcag
gagatcacggctgtgcaggcacgcatgcaggccagctaccgggagcacgtgaaggaggtg
cagcagctgcagggcaagatccggactcttcaggagcagctggagaatggccccaacacg
cagctggcccgcctgcagcaggagaactccatcctgcgggatgccttgaaccaggccacg
agccaggtggagagcaagcagaacgcagagctggccaagcttcggcaggagctcagcaag
gtcagcaaagagctggtggagaagtcagaggctgtgcggcaagatgagcagcagcggaaa
gctctggaagccaaggcagctgccttcgagaagcaggtcctgcagctgcaggcgtcccac
agggagagtgaggaggccctgcagaagcgcctggacgaggtcagccgggagctgtgccac
acgcagagcagccacgccagcctccgggcggatgccgagaaggcccaggagcaacagcag
cagatggccgagctgcacagcaagttacagtcctccgaggcggaggtgcgcagcaaatgc
gaggagctgagtggcctccacgggcagctccaggaggccagggcggagaactcccagctc
acagagagaatccgttccattgaggccctgctggaggcgggccaggcgcgggatgcccag
gacgtccaggccagccaggcggaggctgaccagcagcagactcgcctcaaggagctggag
tcccaggtgtcgggtctggagaaggaggccatcgagctcagggaggccgtcgagcagcag
aaagtgaagaacaatgacctccgggagaagaactggaaggccatggaggcactggccacg
gccgagcaggcctgcaaggagaagctgctctccctgacccaggccaaggaggaatcggag
aagcagctctgtctgattgaggcgcagaccatggaggccctgctggctctgctcccagaa
ctctctgtcttggcacaacagaattacaccgagtggctgcaggatctcaaagagaaaggc
cccacgctgctgaagcacccgccagctcccgcggagccctcctcggacctggcctccaag
ttgagggaggccgaggagacgcagagcacactgcaggccgagtgtgaccagtaccgcagc
atcctggcggagacggagggcatgctcagagacctgcagaagagcgtggaggaggaggag
caggtgtggagggccaaggtgggcgccgcagaggaggagctccagaagtcccgggtcaca
gtgaagcatctcgaagagattgtagagaagctaaaaggagaacttgaaagttcggaccag
gtgagggagcacacgtcgcatttggaggcagagctggaaaagcacatggcggccgccagc
gccgagtgccagaactacgccaaggaggtggcagggctgaggcaacttctcctagaatct
caatctcagctcgatgccgccaagagcgaagcccagaaacagagcgatgagcttgccctg
gtcaggcagcagttgagtgaaatgaagagccacgtagaggatggtgacatagctggggcc
ccagcttcctccccagaggcgcccccagccgagcaggaccccgttcagctgaagacgcag
ctggagtggacagaagccatcctggaggatgagcagacacagcggcagaagctcacggcc
gagtttgaggaggctcagacctcggcatgtcggttacaagaagaattggagaagctccgc
acagccggccccctagagtcttcagaaacagaggaggcctcacagctgaaggagagacta
gaaaaagagaagaagttaacaagtgacctggggcgcgccgccacgagactgcaggagctt
ctgaagacgacccaggagcagctggcaagggagaaggacacggtgaagaagctgcaggaa
cagctggaaaaggcagaggacggcagcagctcaaaggagggcacctctgtctga

DBGET integrated database retrieval system