KEGG   Homo sapiens (human): 624Help
Entry
624               CDS       T01001                                 

Gene name
BDKRB2, B2R, BK-2, BK2, BKR2, BRB2
Definition
(RefSeq) bradykinin receptor B2
  KO
K03916  bradykinin receptor B2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05142  Chagas disease (American trypanosomiasis)
hsa05200  Pathways in cancer
Drug target
Deltibant: D03677
Icatibant: D04492
Labradimil: D08937
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    624 (BDKRB2)
   04071 Sphingolipid signaling pathway
    624 (BDKRB2)
   04022 cGMP - PKG signaling pathway
    624 (BDKRB2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    624 (BDKRB2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    624 (BDKRB2)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    624 (BDKRB2)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    624 (BDKRB2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    624 (BDKRB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    624 (BDKRB2)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    624 (BDKRB2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Bradykinin
    624 (BDKRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 624
NCBI-ProteinID: NP_000614
OMIM: 113503
HGNC: 1030
Ensembl: ENSG00000168398
Vega: OTTHUMG00000171408
Pharos: P30411(Tclin)
UniProt: P30411
Position
14q32.2
AA seq 391 aa AA seqDB search
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN
FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV
IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI
TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP
IQMENSMGTLRTSISVERQIHKLQDWAGSRQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttctctccctggaagatatcaatgtttctgtctgttcgtgaggactccgtgcccacc
acggcctctttcagcgccgacatgctcaatgtcaccttgcaagggcccactcttaacggg
acctttgcccagagcaaatgcccccaagtggagtggctgggctggctcaacaccatccag
ccccccttcctctgggtgctgttcgtgctggccaccctagagaacatctttgtcctcagc
gtcttctgcctgcacaagagcagctgcacggtggcagagatctacctggggaacctggcc
gcagcagacctgatcctggcctgcgggctgcccttctgggccatcaccatctccaacaac
ttcgactggctctttggggagacgctctgccgcgtggtgaatgccattatctccatgaac
ctgtacagcagcatctgtttcctgatgctggtgagcatcgaccgctacctggccctggtg
aaaaccatgtccatgggccggatgcgcggcgtgcgctgggccaagctctacagcttggtg
atctgggggtgtacgctgctcctgagctcacccatgctggtgttccggaccatgaaggag
tacagcgatgagggccacaacgtcaccgcttgtgtcatcagctacccatccctcatctgg
gaagtgttcaccaacatgctcctgaatgtcgtgggcttcctgctgcccctgagtgtcatc
accttctgcacgatgcagatcatgcaggtgctgcggaacaacgagatgcagaagttcaag
gagatccagacagagaggagggccacggtgctagtcctggttgtgctgctgctattcatc
atctgctggctgcccttccagatcagcaccttcctggatacgctgcatcgcctcggcatc
ctctccagctgccaggacgagcgcatcatcgatgtaatcacacagatcgcctccttcatg
gcctacagcaacagctgcctcaacccactggtgtacgtgatcgtgggcaagcgcttccga
aagaagtcttgggaggtgtaccagggagtgtgccagaaagggggctgcaggtcagaaccc
attcagatggagaactccatgggcacactgcggacctccatctccgtggaacgccagatt
cacaaactgcaggactgggcagggagcagacagtga

DBGET integrated database retrieval system