KEGG   Homo sapiens (human): 6241Help
Entry
6241              CDS       T01001                                 

Gene name
RRM2, R2, RR2, RR2M
Definition
(RefSeq) ribonucleotide reductase regulatory subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00480  Glutathione metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa04115  p53 signaling pathway
Drug target
Hydroxycarbamide: D00341
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6241 (RRM2)
   00240 Pyrimidine metabolism
    6241 (RRM2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    6241 (RRM2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    6241 (RRM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    6241 (RRM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6241 (RRM2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     6241 (RRM2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    6241 (RRM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuc_red_sm
Motif
Other DBs
NCBI-GeneID: 6241
NCBI-ProteinID: NP_001025
OMIM: 180390
HGNC: 10452
Ensembl: ENSG00000171848
Vega: OTTHUMG00000090449
Pharos: P31350(Tclin)
UniProt: P31350
Structure
PDB: 

Position
2p25.1
AA seq 389 aa AA seqDB search
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKT
KAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLK
PEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLI
DTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSF
ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE
QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTN
FFEKRVGEYQRMGVMSSPTENSFTLDADF
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgctctccctccgtgtcccgctcgcgcccatcacggacccgcagcagctgcagctctcg
ccgctgaaggggctcagcttggtcgacaaggagaacacgccgccggccctgagcgggacc
cgcgtcctggccagcaagaccgcgaggaggatcttccaggagcccacggagccgaaaact
aaagcagctgcccccggcgtggaggatgagccgctgctgagagaaaacccccgccgcttt
gtcatcttccccatcgagtaccatgatatctggcagatgtataagaaggcagaggcttcc
ttttggaccgccgaggaggtggacctctccaaggacattcagcactgggaatccctgaaa
cccgaggagagatattttatatcccatgttctggctttctttgcagcaagcgatggcata
gtaaatgaaaacttggtggagcgatttagccaagaagttcagattacagaagcccgctgt
ttctatggcttccaaattgccatggaaaacatacattctgaaatgtatagtcttcttatt
gacacttacataaaagatcccaaagaaagggaatttctcttcaatgccattgaaacgatg
ccttgtgtcaagaagaaggcagactgggccttgcgctggattggggacaaagaggctacc
tatggtgaacgtgttgtagcctttgctgcagtggaaggcattttcttttccggttctttt
gcgtcgatattctggctcaagaaacgaggactgatgcctggcctcacattttctaatgaa
cttattagcagagatgagggtttacactgtgattttgcttgcctgatgttcaaacacctg
gtacacaaaccatcggaggagagagtaagagaaataattatcaatgctgttcggatagaa
caggagttcctcactgaggccttgcctgtgaagctcattgggatgaattgcactctaatg
aagcaatacattgagtttgtggcagacagacttatgctggaactgggttttagcaaggtt
ttcagagtagagaacccatttgactttatggagaatatttcactggaaggaaagactaac
ttctttgagaagagagtaggcgagtatcagaggatgggagtgatgtcaagtccaacagag
aattcttttaccttggatgctgacttctaa

DBGET integrated database retrieval system