KEGG   Homo sapiens (human): 6247Help
Entry
6247              CDS       T01001                                 

Gene name
RS1, RS, XLRS1
Definition
(RefSeq) retinoschisin 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: F5_F8_type_C Lyase_N
Motif
Other DBs
NCBI-GeneID: 6247
NCBI-ProteinID: NP_000321
OMIM: 300839
HGNC: 10457
Ensembl: ENSG00000102104
Vega: OTTHUMG00000021216
Pharos: O15537(Tbio)
UniProt: O15537
Structure
PDB: 

Position
Xp22.13
AA seq 224 aa AA seqDB search
MSRKIEGFLLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCI
PECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSS
QWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNS
DRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcaagatagaaggctttttgttattacttctctttggctatgaagccacattg
ggattatcgtctaccgaggatgaaggcgaggacccctggtaccaaaaagcatgcaagtgc
gattgccaaggaggacccaatgctctgtggtctgcaggtgccacctccttggactgtata
ccagaatgcccatatcacaagcctctgggtttcgagtcaggggaggtcacaccggaccag
atcacctgctctaacccggagcagtatgtgggctggtattcttcgtggactgcaaacaag
gcccggctcaacagtcaaggctttgggtgtgcctggctctccaagttccaggacagtagc
cagtggttacagatagatctgaaggagatcaaagtgatttcagggatcctcacccagggg
cgctgtgacatcgatgagtggatgaccaagtacagcgtgcagtacaggaccgatgagcgc
ctgaactggatttactacaaggaccagactggaaacaaccgggtcttctatggcaactcg
gaccgcacctccacggttcagaacctgctgcggccccccatcatctcccgcttcatccgc
ctcatcccgctgggctggcacgtccgcattgccatccggatggagctgctggagtgcgtc
agcaagtgtgcctga

DBGET integrated database retrieval system