KEGG   Homo sapiens (human): 6249
Entry
6249              CDS       T01001                                 

Gene name
CLIP1, CLIP, CLIP-170, CLIP170, CYLN1, RSN
Definition
(RefSeq) CAP-Gly domain containing linker protein 1
  KO
K10421  CAP-Gly domain-containing linker protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    6249 (CLIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    6249 (CLIP1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    6249 (CLIP1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     6249 (CLIP1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Cytoplasmic linker proteins (CLIPs)
     6249 (CLIP1)
SSDB
Motif
Pfam: CAP_GLY CLIP1_ZNF
Other DBs
NCBI-GeneID: 6249
NCBI-ProteinID: NP_001234926
OMIM: 179838
HGNC: 10461
Ensembl: ENSG00000130779
Vega: OTTHUMG00000168922
Pharos: P30622(Tbio)
UniProt: P30622
Structure
PDB: 

Position
12q24.31
AA seq 1438 aa
MSMLKPSGLKAPTKILKPGSTALKTPTAVVAPVEKTISSEKASSTPSSETQEEFVDDFRV
GERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTR
PSKLTRKVQAEDEANGLQTTPASRATSPLCTSTASMVSSSPSTPSNIPQKPSQPAAKEPS
ATPPISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGE
WCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVM
ATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSSRYARKISGTTALQEALKEK
QQHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAA
DREKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEQKSQISEDPENTQTKLEHARIKEL
EQSLLFEKTKADKLQRELEDTRVATVSEKSRIMELEKDLALRVQEVAELRRRLESNKPAG
DVDMSLSLLQEISSLQEKLEVTRTDHQREITSLKEHFGAREETHQKEIKALYTATEKLSK
ENESLKSKLEHANKENSDVIALWKSKLETAIASHQQAMEELKVSFSKGLGTETAEFAELK
TQIEKMRLDYQHEIENLQNQQDSERAAHAKEMEALRAKLMKVIKEKENSLEAIRSKLDKA
EDQHLVEMEDTLNKLQEAEIKVKELEVLQAKCNEQTKVIDNFTSQLKATEEKLLDLDALR
KASSEGKSEMKKLRQQLEAAEKQIKHLEIEKNAESSKASSITRELQGRELKLTNLQENLS
EVSQVKETLEKELQILKEKFAEASEEAVSVQRSMQETVNKLHQKEEQFNMLSSDLEKLRE
NLADMEAKFREKDEREEQLIKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERDVEE
LQLKLTKANENASFLQKSIEDMTVKAEQSQQEAAKKHEEEKKELERKLSDLEKKMETSHN
QCQELKARYERATSETKTKHEEILQNLQKTLLDTEDKLKGAREENSGLLQELEELRKQAD
KAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAKLQNELDTLKENNLKNVEELNKS
KELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEENVKLAEELGRSRDEVTSHQKLE
EERSVLNNQLLEMKKRESKFIKDADEEKASLQKSISITSALLTEKDAELEKLRNEVTVLR
GENASAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGNTDTQADEDERAQE
SQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCD
ICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDETF
NT seq 4317 nt   +upstreamnt  +downstreamnt
atgagtatgctaaagccaagtgggcttaaggcccccaccaagatcctgaagcctggaagc
acagctctgaagacacctacggctgttgtagctccagtagaaaaaaccatatccagtgaa
aaagcatcaagcactccatcatctgagactcaggaggaatttgtggatgactttcgagtt
ggggagcgagtttgggtgaatggaaataagcctggatttatccagtttcttggagaaacc
cagtttgcaccaggccagtgggctggaattgttttagatgaacccataggcaagaacgat
ggttcggtggcaggagttcggtatttccagtgtgaacctttaaagggcatatttacccga
ccttcaaagttaacaaggaaggtgcaagcagaagatgaagctaatggcctgcagacaacg
cccgcctcccgagctacttcaccgctgtgcacttctacggccagcatggtgtcttcctcc
ccctccaccccttcaaacatccctcagaaaccatcacagccagcagcaaaggaaccttca
gctacgcctccgatcagcaaccttacaaaaactgccagtgaatctatctccaacctttca
gaggctggctcaatcaagaaaggagaaagagagctcaaaatcggagacagagtattggtt
ggtggcactaaggctggtgtagtccggtttcttggggagaccgactttgccaagggggag
tggtgtggcgtggagttagatgagccacttgggaagaatgatggcgctgttgctggaaca
aggtattttcagtgtcaacccaaatatggcttgttcgctcctgtccacaaagttaccaag
attggcttcccttccactacaccagccaaagccaaggccaacgcagtgaggcgagtgatg
gcgaccacgtccgccagcctgaagcgcagcccttctgcctcttccctcagctccatgagc
tcagtggcctcctctgtgagcagcaggcccagtcggacaggactattgactgaaacctcc
tcccgttacgccaggaagatctccggtaccactgccctccaggaggccctgaaggagaag
cagcagcacattgagcagctgctggcggaacgggatctggagagggcggaggtggccaag
gccacgagccacgtgggggagatagagcaggagctagctctggcccgggacggacatgac
cagcatgtcctggaattggaagccaaaatggaccagctgcgaacaatggtggaagctgct
gacagggagaaggtggagcttctcaaccagcttgaagaggagaaaaggaaggttgaggac
cttcagttccgggttgaagaagaatcaattaccaaaggtgatcttgagcaaaagagccag
atttctgaagatcctgagaatacgcagaccaaactggagcatgcccgcattaaggagctt
gaacagagcctgctctttgaaaagaccaaagctgacaaactccagagggagttagaagac
actagggtggctacagtttcagaaaagtcacgtataatggaactggagaaagacctagca
ttgagagtacaggaagtagctgagctccgaagaaggctagagtccaataagcctgctggg
gatgtggacatgtcactttcccttttgcaagagataagctctttgcaagaaaagttagaa
gtcacccgtactgaccaccagagagaaataacttctctgaaggagcattttggagcccgg
gaagaaactcatcagaaggagataaaggctctgtataccgccacggaaaagctttccaaa
gagaacgagtcattgaaaagcaagctggagcatgccaacaaagagaactcagatgtgata
gctctatggaagtccaaactggagactgccatcgcatcccaccagcaggcgatggaagaa
ctgaaggtatctttcagcaaagggcttggaacagagacggcagaatttgctgaactaaaa
acacaaatagagaaaatgagactagattaccaacacgaaatagaaaatttgcagaatcaa
caagactctgaacgggctgcccatgctaaagagatggaagccttgagggctaaactgatg
aaagttattaaagaaaaggaaaacagtctggaagccatcaggtcgaaactggacaaagca
gaagaccagcatctcgtagaaatggaagacacgttaaacaaattacaggaagctgaaata
aaggtaaaggagctagaggtactgcaagccaaatgcaatgaacaaaccaaggttattgat
aattttacatcacagctcaaggctactgaagaaaagctcttggatcttgatgcacttcgg
aaagccagttccgaaggtaaatcggaaatgaagaaacttagacagcagcttgaggcagct
gagaaacagattaaacatttagagattgaaaagaatgctgaaagtagcaaggctagtagc
attaccagagagctccaggggagagagctaaagcttactaaccttcaggaaaatttgagt
gaagtcagtcaagtgaaagagactttggaaaaagaacttcagattttgaaagaaaagttt
gctgaagcttcagaggaggcagtctctgttcagagaagtatgcaagaaactgtaaataag
ttacaccaaaaggaggaacagtttaacatgctgtcttctgacttggagaagctgagagaa
aacttagcagatatggaggcaaaatttagagagaaagatgagagagaagagcagctgata
aaggcaaaggaaaaactggaaaatgacattgcagaaataatgaagatgtcaggagataac
tcttctcagctgacaaaaatgaacgatgaattacgtctgaaagaaagagatgtagaagaa
ttacagctaaaacttacaaaggctaatgaaaatgcaagttttctgcaaaaaagtattgag
gacatgactgtcaaagctgaacagagccagcaagaagcagctaaaaagcatgaggaagaa
aagaaagaattggagaggaaattgtcggacctggaaaagaaaatggaaacaagccacaac
cagtgtcaggagctgaaagccaggtatgagagagccacttctgagacaaaaaccaagcat
gaagaaatcctacagaacctccagaagacgctgctggacacagaggacaagctgaagggc
gcacgggaggagaacagtggcttgctgcaggagctggaggagctgagaaagcaagccgac
aaagccaaagctgctcaaacagcggaagatgccatgcagataatggaacagatgaccaaa
gagaagactgagactctggcctccttggaggacaccaagcaaacaaatgcaaaactacag
aatgaattggacacacttaaagaaaacaacttgaaaaatgtggaagagctgaacaaatca
aaagaactcctgactgtagagaatcaaaaaatggaagaatttaggaaagaaatagaaacc
ctaaagcaggcagcagctcagaagtcccagcagctttcagcgttgcaagaagagaacgtt
aaacttgctgaggagctggggagaagcagggacgaagtcacaagtcatcaaaagctggaa
gaagaaagatctgtgctcaataatcagttgttagaaatgaaaaaaagagaatccaagttc
ataaaagacgcagatgaagagaaagcttccttgcagaaatccatcagtataactagtgcc
ttactcacagaaaaggatgccgagctggagaaactgagaaatgaggtcacagtgctcagg
ggagaaaacgcctctgccaagtccttgcattcagttgttcagactctagagtctgataag
gtgaagctcgagctcaaggtaaagaacttggagcttcaactcaaagaaaacaagaggcag
ctcagcagctcctcaggtaatacagacactcaggcagacgaggatgaaagagcccaggag
agtcagattgatttcctaaattcagtaatagtggaccttcaaaggaagaatcaagacctc
aagatgaaggtggagatgatgtcagaagcagccctgaatgggaacggggatgacctaaac
aattatgacagtgatgatcaggagaaacagtccaagaagaaacctcgcctcttctgtgac
atttgtgactgctttgatctccacgacacagaggattgtcctacccaggcacagatgtca
gaggaccctccccattccacacaccatggcagtcggggtgaggaacgcccatactgtgaa
atctgtgagatgtttggacactgggccaccaactgcaatgacgacgaaaccttctga

DBGET integrated database retrieval system