KEGG   Homo sapiens (human): 6256Help
Entry
6256              CDS       T01001                                 

Gene name
RXRA, NR2B1
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  retinoid X receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04659  Th17 cell differentiation
hsa04919  Thyroid hormone signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04976  Bile secretion
hsa05160  Hepatitis C
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05226  Gastric cancer
Network
N00126  PAX8-PPARG fusion to PPARG-mediated transcription
N00269  HCV Core to host-cell-protein activation
Drug target
Acitretin: D02754
Alitretinoin: D02815
Bexarotene: D03106
Etretinate: D00316
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    6256 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    6256 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    6256 (RXRA)
   03320 PPAR signaling pathway
    6256 (RXRA)
   04919 Thyroid hormone signaling pathway
    6256 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    6256 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    6256 (RXRA)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    6256 (RXRA)
   05202 Transcriptional misregulation in cancer
    6256 (RXRA)
  09162 Cancers: Specific types
   05226 Gastric cancer
    6256 (RXRA)
   05216 Thyroid cancer
    6256 (RXRA)
   05222 Small cell lung cancer
    6256 (RXRA)
   05223 Non-small cell lung cancer
    6256 (RXRA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6256 (RXRA)
  09172 Infectious diseases: Viral
   05160 Hepatitis C
    6256 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6256 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    6256 (RXRA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    6256 (RXRA)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   6256 (RXRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 6256
NCBI-ProteinID: NP_002948
OMIM: 180245
HGNC: 10477
Ensembl: ENSG00000186350
Vega: OTTHUMG00000020887
Pharos: P19793(Tclin)
UniProt: P19793 F1D8Q5 Q6P3U7
Structure
PDB: 

Position
9q34.2
AA seq 462 aa AA seqDB search
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgatttctccacccaggtgaactcctccctcacc
tccccgacggggcgaggctccatggctgccccctcgctgcacccgtccctggggcctggc
atcggctccccgggacagctgcattctcccatcagcaccctgagctcccccatcaacggc
atgggcccgcctttctcggtcatcagctcccccatgggcccccactccatgtcggtgccc
accacacccaccctgggcttcagcactggcagcccccagctcagctcacctatgaacccc
gtcagcagcagcgaggacatcaagccccccctgggcctcaatggcgtcctcaaggtcccc
gcccacccctcaggaaacatggcttccttcaccaagcacatctgcgccatctgcggggac
cgctcctcaggcaagcactatggagtgtacagctgcgaggggtgcaagggcttcttcaag
cggacggtgcgcaaggacctgacctacacctgccgcgacaacaaggactgcctgattgac
aagcggcagcggaaccggtgccagtactgccgctaccagaagtgcctggccatgggcatg
aagcgggaagccgtgcaggaggagcggcagcgtggcaaggaccggaacgagaatgaggtg
gagtcgaccagcagcgccaacgaggacatgccggtggagaggatcctggaggctgagctg
gccgtggagcccaagaccgagacctacgtggaggcaaacatggggctgaaccccagctcg
ccgaacgaccctgtcaccaacatttgccaagcagccgacaaacagcttttcaccctggtg
gagtgggccaagcggatcccacacttctcagagctgcccctggacgaccaggtcatcctg
ctgcgggcaggctggaatgagctgctcatcgcctccttctcccaccgctccatcgccgtg
aaggacgggatcctcctggccaccgggctgcacgtccaccggaacagcgcccacagcgca
ggggtgggcgccatctttgacagggtgctgacggagcttgtgtccaagatgcgggacatg
cagatggacaagacggagctgggctgcctgcgcgccatcgtcctctttaaccctgactcc
aaggggctctcgaacccggccgaggtggaggcgctgagggagaaggtctatgcgtccttg
gaggcctactgcaagcacaagtacccagagcagccgggaaggttcgctaagctcttgctc
cgcctgccggctctgcgctccatcgggctcaaatgcctggaacatctcttcttcttcaag
ctcatcggggacacacccattgacaccttccttatggagatgctggaggcgccgcaccaa
atgacttag

DBGET integrated database retrieval system