KEGG   Homo sapiens (human): 627Help
Entry
627               CDS       T01001                                 

Gene name
BDNF, ANON2, BULN2
Definition
(RefSeq) brain derived neurotrophic factor
  KO
K04355  brain-derived neurotrophic factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05016  Huntington disease
hsa05030  Cocaine addiction
hsa05034  Alcoholism
Disease
H00916  Congenital central hypoventilation syndrome
H01450  Obsessive-compulsive disorder
H01703  Eating Disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    627 (BDNF)
   04010 MAPK signaling pathway
    627 (BDNF)
   04024 cAMP signaling pathway
    627 (BDNF)
   04151 PI3K-Akt signaling pathway
    627 (BDNF)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    627 (BDNF)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    627 (BDNF)
  09165 Substance dependence
   05030 Cocaine addiction
    627 (BDNF)
   05034 Alcoholism
    627 (BDNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    627 (BDNF)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   627 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 627
NCBI-ProteinID: NP_001137277
OMIM: 113505
HGNC: 1033
Ensembl: ENSG00000176697
Vega: OTTHUMG00000178797
Pharos: P23560(Tbio)
UniProt: P23560 A0A0E3SU01
Structure
PDB: 

Position
11p14.1
AA seq 247 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLA
DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatactttggttgcatgaaggctgccccc
atgaaagaagcaaacatccgaggacaaggtggcttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaatgggcccaaggcaggttcaagaggcttgacatcattggct
gacactttcgaacacgtgatagaagagctgttggatgaggaccagaaagttcggcccaat
gaagaaaacaataaggacgcagacttgtacacgtccagggtgatgctcagtagtcaagtg
cctttggagcctcctcttctctttctgctggaggaatacaaaaattacctagatgctgca
aacatgtccatgagggtccggcgccactctgaccctgcccgccgaggggagctgagcgtg
tgtgacagtattagtgagtgggtaacggcggcagacaaaaagactgcagtggacatgtcg
ggcgggacggtcacagtccttgaaaaggtccctgtatcaaaaggccaactgaagcaatac
ttctacgagaccaagtgcaatcccatgggttacacaaaagaaggctgcaggggcatagac
aaaaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggcccttaccatg
gatagcaaaaagagaattggctggcgattcataaggatagacacttcttgtgtatgtaca
ttgaccattaaaaggggaagatag

DBGET integrated database retrieval system