KEGG   Homo sapiens (human): 6271Help
Entry
6271              CDS       T01001                                 

Gene name
S100A1, S100, S100-alpha, S100A
Definition
(RefSeq) S100 calcium binding protein A1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_4
Motif
Other DBs
NCBI-GeneID: 6271
NCBI-ProteinID: NP_006262
OMIM: 176940
HGNC: 10486
Ensembl: ENSG00000160678
Vega: OTTHUMG00000037041
Pharos: P23297(Tbio)
UniProt: P23297 A0A0S2Z4H2
Structure
PDB: 

Position
1q21.3
AA seq 94 aa AA seqDB search
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMK
ELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgggctctgagctggagacggcgatggagaccctcatcaacgtgttccacgcccactcg
ggcaaagagggggacaagtacaagctgagcaagaaggagctgaaagagctgctgcagacg
gagctctctggcttcctggatgcccagaaggatgtggatgctgtggacaaggtgatgaag
gagctagacgagaatggagacggggaggtggacttccaggagtatgtggtgcttgtggct
gctctcacagtggcctgtaacaatttcttctgggagaacagttga

DBGET integrated database retrieval system