KEGG   Homo sapiens (human): 6277Help
Entry
6277              CDS       T01001                                 

Gene name
S100A6, 2A9, 5B10, CABP, CACY, PRA, S10A6
Definition
(RefSeq) S100 calcium binding protein A6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: S_100 EF-hand_7 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 6277
NCBI-ProteinID: NP_055439
OMIM: 114110
HGNC: 10496
Ensembl: ENSG00000197956
Vega: OTTHUMG00000013549
Pharos: P06703(Tbio)
UniProt: P06703
Structure
PDB: 

Position
1q21.3
AA seq 90 aa AA seqDB search
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDL
DRNKDQEVNFQEYVTFLGALALIYNEALKG
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atggcatgccccctggatcaggccattggcctcctcgtggccatcttccacaagtactcc
ggcagggagggtgacaagcacaccctgagcaagaaggagctgaaggagctgatccagaag
gagctcaccattggctcgaagctgcaggatgctgaaattgcaaggctgatggaagacttg
gaccggaacaaggaccaggaggtgaacttccaggagtatgtcaccttcctgggggccttg
gctttgatctacaatgaagccctcaagggctga

DBGET integrated database retrieval system