KEGG   Homo sapiens (human): 6279
Entry
6279              CDS       T01001                                 

Gene name
S100A8, 60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8
Definition
(RefSeq) S100 calcium binding protein A8
  KO
K21127  protein S100-A8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6279 (S100A8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    6279 (S100A8)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  S100 proteins
   6279 (S100A8)
SSDB
Motif
Pfam: S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_5 EF-hand_6 EF-hand_11
Other DBs
NCBI-GeneID: 6279
NCBI-ProteinID: NP_001306130
OMIM: 123885
HGNC: 10498
Ensembl: ENSG00000143546
Vega: OTTHUMG00000013124
Pharos: P05109(Tbio)
UniProt: P05109
Structure
PDB: 

Position
1q21.3
AA seq 93 aa
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDI
NTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
NT seq 282 nt   +upstreamnt  +downstreamnt
atgttgaccgagctggagaaagccttgaactctatcatcgacgtctaccacaagtactcc
ctgataaaggggaatttccatgccgtctacagggatgacctgaagaaattgctagagacc
gagtgtcctcagtatatcaggaaaaagggtgcagacgtctggttcaaagagttggatatc
aacactgatggtgcagttaacttccaggagttcctcattctggtgataaagatgggcgtg
gcagcccacaaaaaaagccatgaagaaagccacaaagagtag

DBGET integrated database retrieval system