KEGG   Homo sapiens (human): 6281
Entry
6281              CDS       T01001                                 

Gene name
S100A10, 42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, P11, p10
Definition
(RefSeq) S100 calcium binding protein A10
  KO
K17274  protein S100-A10
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01304  ANXA2-S100A10-regulated actin cytoskeleton
N01305  Salmonella SopB to ANXA2-S100A10-regulated actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    6281 (S100A10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6281 (S100A10)
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    6281 (S100A10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   6281 (S100A10)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  S100 proteins
   6281 (S100A10)
SSDB
Motif
Pfam: S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6
Other DBs
NCBI-GeneID: 6281
NCBI-ProteinID: NP_002957
OMIM: 114085
HGNC: 10487
Ensembl: ENSG00000197747
Vega: OTTHUMG00000013068
Pharos: P60903(Tbio)
UniProt: P60903
Structure
PDB: 

Position
1q21.3
AA seq 97 aa
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD
QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
NT seq 294 nt   +upstreamnt  +downstreamnt
atgccatctcaaatggaacacgccatggaaaccatgatgtttacatttcacaaattcgct
ggggataaaggctacttaacaaaggaggacctgagagtactcatggaaaaggagttccct
ggatttttggaaaatcaaaaagaccctctggctgtggacaaaataatgaaggacctggac
cagtgtagagatggcaaagtgggcttccagagcttcttttccctaattgcgggcctcacc
attgcatgcaatgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system