KEGG   Homo sapiens (human): 6283
Entry
6283              CDS       T01001                                 

Gene name
S100A12, CAAF1, CAGC, CGRP, ENRAGE, MRP-6, MRP6, p6
Definition
(RefSeq) S100 calcium binding protein A12
  KO
K23766  protein S100-A12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    6283 (S100A12)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  S100 proteins
   6283 (S100A12)
SSDB
Motif
Pfam: S_100 EF-hand_1 EF-hand_7 EF-hand_6 DUF5410 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_5
Other DBs
NCBI-GeneID: 6283
NCBI-ProteinID: NP_005612
OMIM: 603112
HGNC: 10489
Ensembl: ENSG00000163221
Vega: OTTHUMG00000013127
Pharos: P80511(Tbio)
UniProt: P80511
Structure
PDB: 

Position
1q21.3
AA seq 92 aa
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQG
LDANQDEQVDFQEFISLVAIALKAAHYHTHKE
NT seq 279 nt   +upstreamnt  +downstreamnt
atgacaaaacttgaagagcatctggagggaattgtcaatatcttccaccaatactcagtt
cggaaggggcattttgacaccctctctaagggtgagctgaagcagctgcttacaaaggag
cttgcaaacaccatcaagaatatcaaagataaagctgtcattgatgaaatattccaaggc
ctggatgctaatcaagatgaacaggtcgactttcaagaattcatatccctggtagccatt
gcgctgaaggctgcccattaccacacccacaaagagtag

DBGET integrated database retrieval system