KEGG   Homo sapiens (human): 6285
Entry
6285              CDS       T01001                                 

Gene name
S100B, NEF, S100, S100-B, S100beta
Definition
(RefSeq) S100 calcium binding protein B
  KO
K23770  protein S100-B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    6285 (S100B)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  S100 proteins
   6285 (S100B)
SSDB
Motif
Pfam: S_100 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_4 EF-hand_5 EF-hand_8
Other DBs
NCBI-GeneID: 6285
NCBI-ProteinID: NP_006263
OMIM: 176990
HGNC: 10500
Ensembl: ENSG00000160307
Vega: OTTHUMG00000090715
Pharos: P04271(Tchem)
UniProt: P04271 A0A0S2Z4C5
Structure
PDB: 

Position
21q22.3
AA seq 92 aa
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
NT seq 279 nt   +upstreamnt  +downstreamnt
atgtctgagctggagaaggccatggtggccctcatcgacgttttccaccaatattctgga
agggagggagacaagcacaagctgaagaaatccgaactgaaggagctcatcaacaatgag
ctttcccatttcttagaggaaatcaaagagcaggaggttgtggacaaagtcatggaaaca
ctggacaatgatggagacggcgaatgtgacttccaggaattcatggcctttgttgccatg
gttactactgcctgccacgagttctttgaacatgagtga

DBGET integrated database retrieval system