KEGG   Homo sapiens (human): 6289
Entry
6289              CDS       T01001                                 

Gene name
SAA2, SAA, SAA1
Definition
(RefSeq) serum amyloid A2
  KO
K17310  serum amyloid A protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6289 (SAA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   6289 (SAA2)
SSDB
Motif
Pfam: SAA
Other DBs
NCBI-GeneID: 6289
NCBI-ProteinID: NP_110381
OMIM: 104751
HGNC: 10514
Ensembl: ENSG00000134339
Vega: OTTHUMG00000166484
Pharos: P0DJI9(Tbio)
UniProt: P0DJI9
Position
11p15.1
AA seq 122 aa
MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNY
DAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPE
KY
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaagcttctcacgggcctggttttctgctccttggtcctgagtgtcagcagccgaagc
ttcttttcgttccttggcgaggcttttgatggggctcgggacatgtggagagcctactct
gacatgagagaagccaattacatcggctcagacaaatacttccatgctcgggggaactat
gatgctgccaaaaggggacctgggggtgcctgggctgcagaagtgatcagcaatgccaga
gagaatatccagagactcacaggccgtggtgcggaggactcgctggccgatcaggctgcc
aataaatggggcaggagtggcagagaccccaatcacttccgacctgctggcctgcctgag
aaatactga

DBGET integrated database retrieval system