KEGG   Homo sapiens (human): 6291
Entry
6291              CDS       T01001                                 

Gene name
SAA4, C-SAA, CSAA
Definition
(RefSeq) serum amyloid A4, constitutive
  KO
K17310  serum amyloid A protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6291 (SAA4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   6291 (SAA4)
SSDB
Motif
Pfam: SAA
Other DBs
NCBI-GeneID: 6291
NCBI-ProteinID: NP_006503
OMIM: 104752
HGNC: 10516
Ensembl: ENSG00000148965
Vega: OTTHUMG00000166483
Pharos: P35542(Tbio)
UniProt: P35542
Position
11p15.1
AA seq 130 aa
MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNY
DAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDR
FRPDGLPKKY
NT seq 393 nt   +upstreamnt  +downstreamnt
atgaggcttttcacaggcattgttttctgctccttggtcatgggagtcaccagtgaaagc
tggcgttcgtttttcaaggaggctctccaaggggttggggacatgggcagagcctattgg
gacataatgatatccaatcaccaaaattcaaacagatatctctatgctcggggaaactat
gatgctgcccaaagaggacctgggggtgtctgggctgctaaactcatcagccgttccagg
gtctatcttcagggattaatagactgctatttatttggaaacagcagcactgtattggag
gactcgaagtccaacgagaaagctgaggaatggggccggagtggcaaagaccccgaccgc
ttcagacctgacggcctgcctaagaaatactga

DBGET integrated database retrieval system