KEGG   Homo sapiens (human): 63027Help
Entry
63027             CDS       T01001                                 

Gene name
SLC22A23, C6orf85
Definition
(RefSeq) solute carrier family 22 member 23
  KO
K08215  MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 23
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    63027 (SLC22A23)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   63027 (SLC22A23)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    63027 (SLC22A23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 63027
NCBI-ProteinID: NP_056297
OMIM: 611697
HGNC: 21106
Ensembl: ENSG00000137266
Vega: OTTHUMG00000014144
Pharos: A1A5C7(Tdark)
UniProt: A1A5C7
Position
6p25.2
AA seq 686 aa AA seqDB search
MAIDRRREAAGGGPGRQPAPAEENGSLPPGDAAASAPLGGRAGPGGGAEIQPLPPLHPGG
GPHPSCCSAAAAPSLLLLDYDGSVLPFLGGLGGGYQKTLVLLTWIPALFIGFSQFSDSFL
LDQPNFWCRGAGKGTELAGVTTTGRGGDMGNWTSLPTTPFATAPWEAAGNRSNSSGADGG
DTPPLPSPPDKGDNASNCDCRAWDYGIRAGLVQNVVSKWDLVCDNAWKVHIAKFSLLVGL
IFGYLITGCIADWVGRRPVLLFSIIFILIFGLTVALSVNVTMFSTLRFFEGFCLAGIILT
LYALRIELCPPGKRFMITMVASFVAMAGQFLMPGLAALCRDWQVLQALIICPFLLMLLYW
SIFPESLRWLMATQQFESAKRLILHFTQKNRMNPEGDIKGVIPELEKELSRRPKKVCIVK
VVGTRNLWKNIVVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSC
LAMCVVVRFLGRRGGLLLFMILTALASLLQLGLLNLIGKYSQHPDSGMSDSVKDKFSIAF
SIVGMFASHAVGSLSVFFCAEITPTVIRCGGLGLVLASAGFGMLTAPIIELHNQKGYFLH
HIIFACCTLICIICILLLPESRDQNLPENISNGEHYTRQPLLPHKKGEQPLLLTNAELKD
YSGLHDAAAAGDTLPEGATANGMKAM
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggccatagaccggcggcgcgaggcggcgggcggcgggcctgggcggcagccggccccg
gccgaggagaacggctccctgccgcccggggacgcggcggcctcggcgcccctcggggga
cgcgcgggccccggcggcggcgcggagatccagccgctgcccccactgcatcctggaggc
ggcccgcacccgagctgctgctccgcggctgcggccccgagcctcttgttgctggactat
gacgggtcggtgctgcccttcctcgggggcctgggcgggggctatcagaagaccctcgtg
ctgctcacctggatcccggcgctgttcatcggcttcagccagttctcggactcgttcctc
ctggaccagcccaacttctggtgccgcggggccggcaaaggcaccgagctggcaggggtc
accaccacaggccggggcggggacatgggcaactggaccagcctccccaccacccccttc
gccactgccccctgggaggctgcgggcaaccggagcaacagcagcggcgcggacggaggc
gacacaccacccctgccatcccctccggacaagggggacaacgcctccaactgtgactgc
cgcgcatgggactacggcatccgcgccggcctcgtccagaacgtggtcagcaagtgggat
cttgtgtgtgataatgcctggaaggtccatatcgctaagttctccttactggttggatta
atctttggctacctaataactggatgcattgctgactgggtcggccggcggcctgtgctg
ctgttttccatcatcttcattctgatctttggactgactgtggcactgtcagtgaatgtg
acaatgttcagcacactcaggttctttgaaggattttgcctggctggaatcattctcacc
ttgtatgctttacgaatagagctgtgcccccctggaaaacggttcatgattacgatggtg
gcgagcttcgtggccatggcgggccagttcctcatgcctgggctagccgccctgtgccgg
gattggcaggtgctgcaggccctcatcatctgccccttcctgctcatgctgctctactgg
tcgatattccccgagtccctccggtggctaatggccacccagcagtttgagtctgcaaag
aggctgatcctccacttcacacagaagaatcgcatgaaccctgagggcgacatcaagggt
gtgataccagagctggagaaagagctttcccggaggcccaagaaggtctgcatcgtgaag
gtggtggggacacggaacctgtggaagaacattgtggtcctgtgtgtgaactcgctgacg
gggtacgggatccaccactgctttgccaggagcatgatgggccacgaggtgaaggtgccg
ctcctggagaacttctatgctgactactataccacggccagcatcgcgctggtgtcctgc
ctggccatgtgcgtggtggtccgattcctcgggcgcaggggagggctgctgctcttcatg
atcctcaccgccctggcctcactcctgcagctcggcctcctcaacctgattggaaagtac
agccagcacccagactcagggatgagtgacagcgtcaaggacaaattttccatcgcgttt
tccatcgtgggcatgtttgcctcccatgcggtggggagcctcagcgtgttcttctgtgcg
gagatcaccccgacggtgataaggtgtggcgggctggggctggtgctggccagcgcgggc
ttcggcatgctgacggcacccatcatcgagctgcacaaccagaaaggctacttcctgcac
cacatcatctttgcctgctgcacgctcatctgcatcatctgcatcctcctgctgcccgag
agcagggaccagaacctgcctgagaacatttctaacggggagcactacacgcgccagccg
ctgctgccgcacaagaagggggagcagccactgctgctcaccaacgccgagctcaaggac
tactcgggcctccacgatgccgcagccgcgggtgacacactgcccgagggtgccacggcc
aacggcatgaaggccatgtag

DBGET integrated database retrieval system