KEGG   Homo sapiens (human): 6303Help
Entry
6303              CDS       T01001                                 

Gene name
SAT1, DC21, KFSD, KFSDX, SAT, SSAT, SSAT-1
Definition
(RefSeq) spermidine/spermine N1-acetyltransferase 1
  KO
K00657  diamine N-acetyltransferase [EC:2.3.1.57]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
hsa04216  Ferroptosis
Module
hsa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H00750  Keratosis follicularis spinulosa decalvans
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    6303 (SAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    6303 (SAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.57  diamine N-acetyltransferase
     6303 (SAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_3 FR47 Acetyltransf_4
Motif
Other DBs
NCBI-GeneID: 6303
NCBI-ProteinID: NP_002961
OMIM: 313020
HGNC: 10540
Ensembl: ENSG00000130066
Vega: OTTHUMG00000021256
Pharos: P21673(Tbio)
UniProt: P21673
Structure
PDB: 

Position
Xp22.11
AA seq 171 aa AA seqDB search
MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVP
KEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRC
RCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattcgtgatccgcccagccactgccgccgactgcagtgacatactgcggctg
atcaaggagctggctaaatatgaatacatggaagaacaagtaatcttaactgaaaaagat
ctgctagaagatggttttggagagcaccccttttaccactgcctggttgcagaagtgccg
aaagagcactggactccggaaggacacagcattgttggttttgccatgtactattttacc
tatgacccgtggattggcaagttattgtatcttgaggacttcttcgtgatgagtgattat
agaggctttggcataggatcagaaattctgaagaatctaagccaggttgcaatgaggtgt
cgctgcagcagcatgcacttcttggtagcagaatggaatgaaccatccatcaacttctat
aaaagaagaggtgcttctgatctgtccagtgaagagggttggagactgttcaagatcgac
aaggagtacttgctaaaaatggcaacagaggagtga

DBGET integrated database retrieval system