KEGG   Homo sapiens (human): 63036
Entry
63036             CDS       T01001                                 

Symbol
CELA2A, AOMS4, ELA2A, PE-1
Name
(RefSeq) chymotrypsin like elastase 2A
  KO
K01346  pancreatic elastase II [EC:3.4.21.71]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Disease
H02384  Abdominal obesity-metabolic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    63036 (CELA2A)
   04974 Protein digestion and absorption
    63036 (CELA2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    63036 (CELA2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.71  pancreatic elastase II
     63036 (CELA2A)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   63036 (CELA2A)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 63036
NCBI-ProteinID: NP_254275
OMIM: 609443
HGNC: 24609
Ensembl: ENSG00000142615
Vega: OTTHUMG00000002258
Pharos: P08217(Tdark)
UniProt: P08217
Position
1p36.21
AA seq 269 aa
MIRTLLLSTLVAGALSCGDPTYPPYVTRVVGGEEARPNSWPWQVSLQYSSNGKWYHTCGG
SLIANSWVLTAAHCISSSRTYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGN
DIALLKLANPVSLTDKIQLACLPPAGTILPNNYPCYVTGWGRLQTNGAVPDVLQQGRLLV
VDYATCSSSAWWGSSVKTSMICAGGDGVISSCNGDSGGPLNCQASDGRWQVHGIVSFGSR
LGCNYYHKPSVFTRVSNYIDWINSVIANN
NT seq 810 nt   +upstreamnt  +downstreamnt
atgataaggacgctgctgctgtccactttggtggctggagccctcagttgtggggacccc
acttacccaccttatgtgactagggtggttggcggtgaagaagcgaggcccaacagctgg
ccctggcaggtctccctgcagtacagctccaatggcaagtggtaccacacctgcggaggg
tccctgatagccaacagctgggtcctgacggctgcccactgcatcagctcctccaggacc
taccgcgtggggctgggccggcacaacctctacgttgcggagtccggctcgctggcagtc
agtgtctctaagattgtggtgcacaaggactggaactccaaccaaatctccaaagggaac
gacattgccctgctcaaactggctaaccccgtctccctcaccgacaagatccagctggcc
tgcctccctcctgccggcaccattctacccaacaactacccctgctacgtcacgggctgg
ggaaggctgcagaccaacggggctgttcctgatgtcctgcagcagggccggttgctggtt
gtggactatgccacctgctccagctctgcctggtggggcagcagcgtgaaaaccagtatg
atctgtgctgggggtgatggcgtgatctccagctgcaacggagactctggcgggccactg
aactgtcaggcgtctgacggccggtggcaggtgcacggcatcgtcagcttcgggtctcgc
ctcggctgcaactactaccacaagccctccgtcttcacgcgggtctccaattacatcgac
tggatcaattcggtgattgcaaataactaa

DBGET integrated database retrieval system