KEGG   Homo sapiens (human): 6304Help
Entry
6304              CDS       T01001                                 

Gene name
SATB1
Definition
(RefSeq) SATB homeobox 1
  KO
K23225  DNA-binding protein SATB1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    6304 (SATB1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    6304 (SATB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUT CUTL ULD Homeodomain HTH_3 RuvA_C SUIM_assoc
Motif
Other DBs
NCBI-GeneID: 6304
NCBI-ProteinID: NP_001124482
OMIM: 602075
HGNC: 10541
Ensembl: ENSG00000182568
Vega: OTTHUMG00000129890
Pharos: Q01826(Tbio)
UniProt: Q01826 A0A024R2H1
Structure
PDB: 

Position
3p24.3
AA seq 763 aa AA seqDB search
MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHS
GHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGY
SHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLP
PEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWY
KHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRTPL
PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKP
LEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ
SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIA
TERNGKPENNTMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSP
ENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQQQQQQQQ
QQQQQQQAPPPPQPQQQPQTGPRLPPRQPTVASPAESDEENRQKTRPRTKISVEALGILQ
SFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYLKHHGKLKDNSGLEVDVAEYK
EEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggatcatttgaacgaggcaactcaggggaaagaacattcagaaatgtctaacaatgtg
agtgatccgaagggtccaccagccaagattgcccgcctggagcagaacgggagcccgcta
ggaagaggaaggcttgggagtacaggtgcaaaaatgcagggagtgcctttaaaacactcg
ggccatctgatgaaaaccaaccttaggaaaggaaccatgctgccagttttctgtgtggtg
gaacattatgaaaacgccattgaatatgattgcaaggaggagcatgcagaatttgtgctg
gtgagaaaggatatgcttttcaaccagctgatcgaaatggcattgctgtctctaggttat
tcacatagctctgctgcccaggccaaagggctaatccaggttggaaagtggaatccagtt
ccactgtcttacgtgacagatgcccctgatgctacagtagcagatatgcttcaagatgtg
tatcatgtggtcacattgaaaattcagttacacagttgccccaaactagaagacttgcct
cccgaacaatggtcgcacaccacagtgaggaatgctctgaaggacttactgaaagatatg
aatcagagttcattggccaaggagtgccccctttcacagagtatgatttcttccattgtg
aacagtacttactatgcaaatgtctcagcagcaaaatgtcaagaatttggaaggtggtac
aaacatttcaagaagacaaaagatatgatggttgaaatggatagtctttctgagctatcc
cagcaaggcgccaatcatgtcaattttggccagcaaccagttccagggaacacagccgag
cagcctccatcccctgcgcagctctcccatggcagccagccctctgtccggacacctctt
ccaaacctgcaccctgggctcgtatcaacacctatcagtcctcaattggtcaaccagcag
ctggtgatggctcagctgctgaaccagcagtatgcagtgaatagacttttagcccagcag
tccttaaaccaacaatacttgaaccaccctccccctgtcagtagatctatgaataagcct
ttggagcaacaggtttcgaccaacacagaggtgtcttccgaaatctaccagtgggtacgc
gatgaactgaaacgagcaggaatctcccaggcggtatttgcacgtgtggcttttaacaga
actcagggcttgctttcagaaatcctccgaaaggaagaggaccccaagactgcatcccag
tctttgctggtaaaccttcgggctatgcagaatttcttgcagttaccggaagctgaaaga
gaccgaatataccaggacgaaagggaaaggagcttgaatgctgcctcggccatgggtcct
gcccccctcatcagcacaccacccagccgtcctccccaggtgaaaacagctactattgcc
actgaaaggaatgggaaaccagagaacaataccatgaacattaatgcttccatttatgat
gagattcagcaggaaatgaagcgtgctaaagtgtctcaagcactgtttgcaaaggttgca
gcaaccaaaagccagggatggttgtgcgagctgttacgctggaaagaagatccttctcca
gaaaacagaaccctgtgggagaacctctccatgatccgaaggttcctcagtcttcctcag
ccagaacgtgatgccatttatgaacaggagagcaacgcggtgcatcaccatggcgacagg
ccgccccacattatccatgttccagcagagcagattcagcaacagcagcagcaacagcaa
cagcagcagcagcagcagcaggcaccgccgcctccacagccacagcagcagccacagaca
ggccctcggctccccccacggcaacccacggtggcctctccagcagagtcagatgaggaa
aaccgacagaagacccggccacgaacaaaaatttcagtggaagccttgggaatcctccag
agtttcatacaagacgtgggcctgtaccctgacgaagaggccatccagactctgtctgcc
cagctcgaccttcccaagtacaccatcatcaagttctttcagaaccagcggtactatctc
aagcaccacggcaaactgaaggacaattccggtttagaggtcgatgtggcagaatataaa
gaagaggagctgctgaaggatttggaagagagtgtccaagataaaaatactaacaccctt
ttttcagtgaaactagaagaagagctgtcagtggaaggaaacacagacattaatactgat
ttgaaagactga

DBGET integrated database retrieval system