KEGG   Homo sapiens (human): 6307Help
Entry
6307              CDS       T01001                                 

Gene name
MSMO1, DESP4, ERG25, MCCPD, SC4MOL
Definition
(RefSeq) methylsterol monooxygenase 1
  KO
K07750  methylsterol monooxygenase [EC:1.14.18.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Disease
H02132  Microcephaly syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    6307 (MSMO1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.9  methylsterol monooxygenase
     6307 (MSMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_hydroxylase DUF4886
Motif
Other DBs
NCBI-GeneID: 6307
NCBI-ProteinID: NP_006736
OMIM: 607545
HGNC: 10545
Ensembl: ENSG00000052802
Vega: OTTHUMG00000161126
Pharos: Q15800(Tbio)
UniProt: Q15800
Position
4q32.3
AA seq 293 aa AA seqDB search
MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHEA
LYFLFCLPGFLFQFIPYMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFT
EYFNIPYDWERMPRWYFLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPF
GMEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNL
IPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaatgaaagtgtcagcatctttagttcagcatccttggctgtggaatatgta
gattcacttttacctgagaatcctctgcaagaaccatttaaaaatgcttggaactatatg
ttgaataattatacaaagttccagattgcaacatggggatcccttatagttcatgaagcc
ctttatttcttattctgtttacctggatttttatttcaatttataccttatatgaaaaaa
tacaaaattcaaaaggataagccagagacatgggaaaaccaatggaagtgtttcaaagtt
cttctctttaatcacttctgtatccagctgcctttgatttgtggaacctattattttaca
gagtatttcaatattccttatgattgggaaagaatgccaagatggtattttcttttggca
agatgctttggttgtgcagtcattgaagatacttggcactattttctgcatagactctta
caccacaaaagaatatacaagtatattcataaagttcatcatgagtttcaggctccattt
ggaatggaagctgaatatgcacatcctttggagactctaattcttggaactggatttttc
attggaatcgtgcttttgtgtgatcatgtaattcttctttgggcatgggtgaccattcgt
ttattagaaactattgatgtccatagtggttatgatattcctctcaaccctttaaatctg
atccctttctatgctggttctcggcatcatgatttccaccacatgaacttcattggaaac
tatgcttcaacatttacatggtgggatcgaatttttggaacagactctcagtataatgcc
tataatgaaaagaggaagaagtttgagaaaaagactgaataa

DBGET integrated database retrieval system