KEGG   Homo sapiens (human): 6318Help
Entry
6318              CDS       T01001                                 

Gene name
SERPINB4, LEUPIN, PI11, SCCA-2, SCCA1, SCCA2
Definition
(RefSeq) serpin family B member 4
  KO
K13963  serpin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    6318 (SERPINB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin TctC
Motif
Other DBs
NCBI-GeneID: 6318
NCBI-ProteinID: NP_002965
OMIM: 600518
HGNC: 10570
Ensembl: ENSG00000206073
Vega: OTTHUMG00000060405
Pharos: P48594(Tbio)
UniProt: P48594
Position
18q21.33
AA seq 390 aa AA seqDB search
MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFD
QVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYL
DAIKKFYQTSVESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAI
YFKGQWENKFKKENTKEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKD
LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLR
TMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTN
EEFCCNHPFLFFIRQNKTNSILFYGRFSSP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaattcactcagtgaagccaacaccaagttcatgttcgatctgttccaacagttcaga
aaatcaaaagagaacaacatcttctattcccctatcagcatcacatcagcattagggatg
gtcctcttaggagccaaagacaacactgcacaacaaattagcaaggttcttcactttgat
caagtcacagagaacaccacagaaaaagctgcaacatatcatgttgataggtcaggaaat
gttcatcaccagtttcaaaagcttctgactgaattcaacaaatccactgatgcatatgag
ctgaagatcgccaacaagctcttcggagaaaagacgtatcaatttttacaggaatattta
gatgccatcaagaaattttaccagaccagtgtggaatctactgattttgcaaatgctcca
gaagaaagtcgaaagaagattaactcctgggtggaaagtcaaacgaatgaaaaaattaaa
aacctatttcctgatgggactattggcaatgatacgacactggttcttgtgaacgcaatc
tatttcaaagggcagtgggagaataaatttaaaaaagaaaacactaaagaggaaaaattt
tggccaaacaagaatacatacaaatctgtacagatgatgaggcaatacaattcctttaat
tttgccttgctggaggatgtacaggccaaggtcctggaaataccatacaaaggcaaagat
ctaagcatgattgtgctgctgccaaatgaaatcgatggtctgcagaagcttgaagagaaa
ctcactgctgagaaattgatggaatggacaagtttgcagaatatgagagagacatgtgtc
gatttacacttacctcggttcaaaatggaagagagctatgacctcaaggacacgttgaga
accatgggaatggtgaatatcttcaatggggatgcagacctctcaggcatgacctggagc
cacggtctctcagtatctaaagtcctacacaaggcctttgtggaggtcactgaggaggga
gtggaagctgcagctgccaccgctgtagtagtagtcgaattatcatctccttcaactaat
gaagagttctgttgtaatcaccctttcctattcttcataaggcaaaataagaccaacagc
atcctcttctatggcagattctcatccccatag

DBGET integrated database retrieval system