KEGG   Homo sapiens (human): 6327Help
Entry
6327              CDS       T01001                                 

Gene name
SCN2B, ATFB14
Definition
(RefSeq) sodium voltage-gated channel beta subunit 2
  KO
K04846  voltage-gated sodium channel type II beta
Organism
hsa  Homo sapiens (human)
Disease
H00731  Atrial fibrillation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    6327 (SCN2B)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   6327 (SCN2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig I-set Ig_3 Adeno_E3_CR2 Syndecan EphA2_TM Ig_2 FAM176 Protocadherin SKG6
Motif
Other DBs
NCBI-GeneID: 6327
NCBI-ProteinID: NP_004579
OMIM: 601327
HGNC: 10589
Ensembl: ENSG00000149575
Vega: OTTHUMG00000048248
Pharos: O60939(Tbio)
UniProt: O60939 Q5U0K8
Structure
PDB: 

Position
11q23.3
AA seq 215 aa AA seqDB search
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNH
KQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPE
DEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVV
KCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcacagagatgcctggctacctcgccctgccttcagcctcacggggctcagtctcttt
ttctctttggtgccaccaggacggagcatggaggtcacagtacctgccaccctcaacgtc
ctcaatggctctgacgcccgcctgccctgcaccttcaactcctgctacacagtgaaccac
aaacagttctccctgaactggacttaccaggagtgcaacaactgctctgaggagatgttc
ctccagttccgcatgaagatcattaacctgaagctggagcggtttcaagaccgcgtggag
ttctcagggaaccccagcaagtacgatgtgtcggtgatgctgagaaacgtgcagccggag
gatgaggggatttacaactgctacatcatgaacccccctgaccgccaccgtggccatggc
aagatccatctgcaggtcctcatggaagagccccctgagcgggactccacggtggccgtg
attgtgggtgcctccgtcgggggcttcctggctgtggtcatcttggtgctgatggtggtc
aagtgtgtgaggagaaaaaaagagcagaagctgagcacagatgacctgaagaccgaggag
gagggcaagacggacggtgaaggcaacccggatgatggcgccaagtag

DBGET integrated database retrieval system