KEGG   Homo sapiens (human): 633Help
Entry
633               CDS       T01001                                 

Gene name
BGN, DSPG1, MRLS, PG-S1, PGI, SEMDX, SLRR1A
Definition
(RefSeq) biglycan
  KO
K08118  biglycan
Organism
hsa  Homo sapiens (human)
Disease
H02187  Spondyloepimetaphyseal dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    633 (BGN)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class I
    633 (BGN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_9 LRR_5
Motif
Other DBs
NCBI-GeneID: 633
NCBI-ProteinID: NP_001702
OMIM: 301870
HGNC: 1044
Ensembl: ENSG00000182492
Vega: OTTHUMG00000024205
Pharos: P21810(Tbio)
UniProt: P21810 B4DNL4
Position
Xq28
AA seq 368 aa AA seqDB search
MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYS
AMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALV
LVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFS
GLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNK
IQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLK
LLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLA
IQFGNYKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccctgtggcgcctcgtgtctctgctggccctgagccaggccctgccctttgag
cagagaggcttctgggacttcaccctggacgatgggccattcatgatgaacgatgaggaa
gcttcgggcgctgacacctcgggcgtcctggacccggactctgtcacacccacctacagc
gccatgtgtcctttcggctgccactgccacctgcgggtggttcagtgctccgacctgggt
ctgaagtctgtgcccaaagagatctcccctgacaccacgctgctggacctgcagaacaac
gacatctccgagctccgcaaggatgacttcaagggtctccagcacctctacgccctcgtc
ctggtgaacaacaagatctccaagatccatgagaaggccttcagcccactgcggaagctg
cagaagctctacatctccaagaaccacctggtggagatcccgcccaacctacccagctcc
ctggtggagctccgcatccacgacaaccgcatccgcaaggtgcccaagggagtgttcagc
gggctccggaacatgaactgcatcgagatgggcgggaacccactggagaacagtggcttt
gaacctggagccttcgatggcctgaagctcaactacctgcgcatctcagaggccaagctg
actggcatccccaaagacctccctgagaccctgaatgaactccacctagaccacaacaaa
atccaggccatcgaactggaggacctgcttcgctactccaagctgtacaggctgggccta
ggccacaaccagatcaggatgatcgagaacgggagcctgagcttcctgcccaccctccgg
gagctccacttggacaacaacaagttggccagggtgccctcagggctcccagacctcaag
ctcctccaggtggtctatctgcactccaacaacatcaccaaagtgggtgtcaacgacttc
tgtcccatgggcttcggggtgaagcgggcctactacaacggcatcagcctcttcaacaac
cccgtgccctactgggaggtgcagccggccactttccgctgcgtcactgaccgcctggcc
atccagtttggcaactacaaaaagtag

DBGET integrated database retrieval system