KEGG   Homo sapiens (human): 634
Entry
634               CDS       T01001                                 
Symbol
CEACAM1, BGP, BGP1, BGPI
Name
(RefSeq) CEA cell adhesion molecule 1
  KO
K06499  carcinoembryonic antigen-related cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Drug target
Arcitumomab: D02977
Cergutuzumab: D11110
Cergutuzumab amunaleukin: D10917
Indium (111In) pentetic acid (DG01189): D04524
Labetuzumab: D08936
Technetium (99mTc) arcitumomab: D06028
Yttrium Y 90 labetuzumab: D06350
Yttrium Y 90 labetuzumab tetraxetan: D06351
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    634 (CEACAM1)
   04147 Exosome [BR:hsa04147]
    634 (CEACAM1)
   04090 CD molecules [BR:hsa04090]
    634 (CEACAM1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    634 (CEACAM1)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   634 (CEACAM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   634 (CEACAM1)
  Exosomal proteins of bladder cancer cells
   634 (CEACAM1)
CD molecules [BR:hsa04090]
 Proteins
  634 (CEACAM1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  634 (CEACAM1)
SSDB
Motif
Pfam: Ig_3 ig Ig_2 I-set V-set Ig_4 Ig_6 Receptor_2B4 Ig_5 Izumo-Ig CYYR1 C2-set_2 DUF4690 V-set_CD47 Form-deh_trans
Other DBs
NCBI-GeneID: 634
NCBI-ProteinID: NP_001703
OMIM: 109770
HGNC: 1814
Ensembl: ENSG00000079385
Pharos: P13688(Tbio)
UniProt: P13688
Structure
Position
19:complement(42507306..42528481)
AA seq 526 aa
MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQ
QLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFY
TLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWI
NNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTP
TISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCH
ANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWF
FKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALP
QENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDH
SNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggggcacctctcagccccacttcacagagtgcgtgtaccctggcaggggcttctgctc
acagcctcacttctaaccttctggaacccgcccaccactgcccagctcactactgaatcc
atgccattcaatgttgcagaggggaaggaggttcttctccttgtccacaatctgccccag
caactttttggctacagctggtacaaaggggaaagagtggatggcaaccgtcaaattgta
ggatatgcaataggaactcaacaagctaccccagggcccgcaaacagcggtcgagagaca
atataccccaatgcatccctgctgatccagaacgtcacccagaatgacacaggattctac
accctacaagtcataaagtcagatcttgtgaatgaagaagcaactggacagttccatgta
tacccggagctgcccaagccctccatctccagcaacaactccaaccctgtggaggacaag
gatgctgtggccttcacctgtgaacctgagactcaggacacaacctacctgtggtggata
aacaatcagagcctcccggtcagtcccaggctgcagctgtccaatggcaacaggaccctc
actctactcagtgtcacaaggaatgacacaggaccctatgagtgtgaaatacagaaccca
gtgagtgcgaaccgcagtgacccagtcaccttgaatgtcacctatggcccggacaccccc
accatttccccttcagacacctattaccgtccaggggcaaacctcagcctctcctgctat
gcagcctctaacccacctgcacagtactcctggcttatcaatggaacattccagcaaagc
acacaagagctctttatccctaacatcactgtgaataatagtggatcctatacctgccac
gccaataactcagtcactggctgcaacaggaccacagtcaagacgatcatagtcactgag
ctaagtccagtagtagcaaagccccaaatcaaagccagcaagaccacagtcacaggagat
aaggactctgtgaacctgacctgctccacaaatgacactggaatctccatccgttggttc
ttcaaaaaccagagtctcccgtcctcggagaggatgaagctgtcccagggcaacaccacc
ctcagcataaaccctgtcaagagggaggatgctgggacgtattggtgtgaggtcttcaac
ccaatcagtaagaaccaaagcgaccccatcatgctgaacgtaaactataatgctctacca
caagaaaatggcctctcacctggggccattgctggcattgtgattggagtagtggccctg
gttgctctgatagcagtagccctggcatgttttctgcatttcgggaagaccggcagggca
agcgaccagcgtgatctcacagagcacaaaccctcagtctccaaccacactcaggaccac
tccaatgacccacctaacaagatgaatgaagttacttattctaccctgaactttgaagcc
cagcaacccacacaaccaacttcagcctccccatccctaacagccacagaaataatttat
tcagaagtaaaaaagcagtaa

DBGET integrated database retrieval system