KEGG   Homo sapiens (human): 634Help
Entry
634               CDS       T01001                                 

Gene name
CEACAM1, BGP, BGP1, BGPI
Definition
(RefSeq) carcinoembryonic antigen related cell adhesion molecule 1
  KO
K06499  carcinoembryonic antigen-related cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Drug target
Arcitumomab: D02977
Cergutuzumab amunaleukin: D10917
Indium (111In) pentetic acid (DG01189): D04524
Labetuzumab: D08936
Technetium (99mTc) arcitumomab: D06028
Yttrium Y 90 labetuzumab: D06350
Yttrium Y 90 labetuzumab tetraxetan: D06351
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    634 (CEACAM1)
   04090 CD molecules [BR:hsa04090]
    634 (CEACAM1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    634 (CEACAM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   634 (CEACAM1)
  Exosomal proteins of bladder cancer cells
   634 (CEACAM1)
CD molecules [BR:hsa04090]
 Proteins
  634 (CEACAM1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  634 (CEACAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 ig Ig_2 I-set V-set Ig_4 Ig_5 Receptor_2B4 Izumo-Ig CYYR1 V-set_CD47 DUF4690 Form-deh_trans
Motif
Other DBs
NCBI-GeneID: 634
NCBI-ProteinID: NP_001703
OMIM: 109770
HGNC: 1814
Ensembl: ENSG00000079385
Vega: OTTHUMG00000151078
Pharos: P13688(Tbio)
UniProt: P13688
Structure
PDB: 

Position
19q13.2
AA seq 526 aa AA seqDB search
MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQ
QLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFY
TLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWI
NNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTP
TISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCH
ANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWF
FKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALP
QENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDH
SNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggggcacctctcagccccacttcacagagtgcgtgtaccctggcaggggcttctgctc
acagcctcacttctaaccttctggaacccgcccaccactgcccagctcactactgaatcc
atgccattcaatgttgcagaggggaaggaggttcttctccttgtccacaatctgccccag
caactttttggctacagctggtacaaaggggaaagagtggatggcaaccgtcaaattgta
ggatatgcaataggaactcaacaagctaccccagggcccgcaaacagcggtcgagagaca
atataccccaatgcatccctgctgatccagaacgtcacccagaatgacacaggattctac
accctacaagtcataaagtcagatcttgtgaatgaagaagcaactggacagttccatgta
tacccggagctgcccaagccctccatctccagcaacaactccaaccctgtggaggacaag
gatgctgtggccttcacctgtgaacctgagactcaggacacaacctacctgtggtggata
aacaatcagagcctcccggtcagtcccaggctgcagctgtccaatggcaacaggaccctc
actctactcagtgtcacaaggaatgacacaggaccctatgagtgtgaaatacagaaccca
gtgagtgcgaaccgcagtgacccagtcaccttgaatgtcacctatggcccggacaccccc
accatttccccttcagacacctattaccgtccaggggcaaacctcagcctctcctgctat
gcagcctctaacccacctgcacagtactcctggcttatcaatggaacattccagcaaagc
acacaagagctctttatccctaacatcactgtgaataatagtggatcctatacctgccac
gccaataactcagtcactggctgcaacaggaccacagtcaagacgatcatagtcactgag
ctaagtccagtagtagcaaagccccaaatcaaagccagcaagaccacagtcacaggagat
aaggactctgtgaacctgacctgctccacaaatgacactggaatctccatccgttggttc
ttcaaaaaccagagtctcccgtcctcggagaggatgaagctgtcccagggcaacaccacc
ctcagcataaaccctgtcaagagggaggatgctgggacgtattggtgtgaggtcttcaac
ccaatcagtaagaaccaaagcgaccccatcatgctgaacgtaaactataatgctctacca
caagaaaatggcctctcacctggggccattgctggcattgtgattggagtagtggccctg
gttgctctgatagcagtagccctggcatgttttctgcatttcgggaagaccggcagggca
agcgaccagcgtgatctcacagagcacaaaccctcagtctccaaccacactcaggaccac
tccaatgacccacctaacaagatgaatgaagttacttattctaccctgaactttgaagcc
cagcaacccacacaaccaacttcagcctccccatccctaacagccacagaaataatttat
tcagaagtaaaaaagcagtaa

DBGET integrated database retrieval system