KEGG   Homo sapiens (human): 6342Help
Entry
6342              CDS       T01001                                 

Gene name
SCP2, NLTP, NSL-TP, SCP-2, SCP-CHI, SCP-X, SCPX
Definition
(RefSeq) sterol carrier protein 2
  KO
K08764  sterol carrier protein 2 [EC:2.3.1.176]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
hsa_M00861  beta-Oxidation, peroxisome, VLCFA
hsa_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Disease
H00407  Peroxisomal beta-oxidation enzyme deficiency
H00874  Leukoencephalopathy with dystonia and motor neuropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    6342 (SCP2)
   01040 Biosynthesis of unsaturated fatty acids
    6342 (SCP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    6342 (SCP2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    6342 (SCP2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.176  propanoyl-CoA C-acyltransferase
     6342 (SCP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCP2 Thiolase_N Thiolase_C Alkyl_sulf_C ACP_syn_III SCP2_2 Ketoacyl-synt_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-GeneID: 6342
NCBI-ProteinID: NP_002970
OMIM: 184755
HGNC: 10606
Ensembl: ENSG00000116171
Vega: OTTHUMG00000008936
Pharos: P22307(Tchem)
UniProt: P22307 A0A384NY87 B2R761 Q59HG9
Structure
PDB: 

Position
1p32.3
AA seq 547 aa AA seqDB search
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQA
CVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALG
FEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEH
FAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEA
FVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDID
VIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGAT
GLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIE
AVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKN
GKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQL
QPGNAKL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcttccccgtgggagcctgcgaccctgcgccgggtgttcgtggtgggggttggc
atgaccaagtttgtgaagcctggagctgagaattcaagagactaccctgacttggcagaa
gaagcaggcaagaaggctttagctgatgcacagatcccttattcagcagtggaccaggca
tgtgttggctatgtttttggtgactctacctgtgggcagagggctatctatcacagtttg
ggaatgactggaattcctataatcaatgtcaacaataactgtgctactggttctactgct
ttgtttatggcccgccagctgattcagggtggtgtggcagaatgtgtcttggctcttggg
tttgagaagatgagtaagggaagccttggaataaaattttcagatagaaccattcccact
gataagcatgttgacctcctgatcaataagtatggattgtctgctcacccagttgctcct
cagatgtttgggtatgctggaaaagaacatatggaaaaatatggaacaaaaattgaacac
tttgcaaaaattggatggaaaaatcataaacattcagttaataacccgtattcccagttc
caagatgaatacagtttagatgaagtgatggcatctaaagaagtttttgattttttgact
atcttacaatgttgtcccacttcagatggtgctgcagcagcaattttggccagtgaagca
tttgtacagaagtatggcctgcaatccaaagctgtggaaattttggcacaagaaatgatg
actgatttgccaagctcgtttgaagaaaaaagcattattaaaatggttggctttgatatg
agtaaagaagctgcaagaaaatgctatgagaaatctggcctgacaccaaatgatattgac
gtaatagaacttcacgattgcttttctaccaacgaactccttacttatgaagcactggga
ctctgtccagaaggacaaggtgcaacgctggttgatagaggagataatacatatggagga
aagtgggtcataaatcctagtggtggactgatttcaaagggacacccactaggcgctaca
ggtcttgctcagtgtgcagaactctgctggcagctgagaggggaagccggaaagaggcaa
gttcctggtgcaaaggtggctctgcagcataatttaggcattggaggagctgtggttgta
acactctacaagatgggttttccggaagccgccagttcttttagaactcatcaaattgaa
gctgttccaaccagctctgcaagtgatggatttaaggcaaatcttgtttttaaggagatt
gagaagaaacttgaagaggaaggggaacagtttgtgaagaaaatcggtggtatttttgcc
ttcaaggtgaaagatggccctgggggtaaagaggccacctgggtggtggatgtgaagaat
ggcaaaggatcagtgcttcctaactcagataagaaggctgactgcacaatcacaatggct
gactcagacttcctggctttaatgactggtaaaatgaatcctcagtcggccttctttcaa
ggcaaattgaaaatcactggcaacatgggtctcgctatgaagttacaaaatcttcagctt
cagccaggcaacgctaagctctga

DBGET integrated database retrieval system