KEGG   Homo sapiens (human): 6343Help
Entry
6343              CDS       T01001                                 

Gene name
SCT
Definition
(RefSeq) secretin
  KO
K05263  secretin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6343 (SCT)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    6343 (SCT)
   04976 Bile secretion
    6343 (SCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_2
Motif
Other DBs
NCBI-GeneID: 6343
NCBI-ProteinID: NP_068739
OMIM: 182099
HGNC: 10607
Ensembl: ENSG00000070031
Vega: OTTHUMG00000133313
Pharos: P09683(Tbio)
CPD: C13523
UniProt: P09683
Position
11p15.5
AA seq 121 aa AA seqDB search
MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQ
DAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRP
R
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggccccccggcccctcctgctgctgctgctgctcctcgggggctccgccgcgcgcccc
gcgccccccagggcccggcgacactcagacgggacgttcaccagcgagctcagccgcctg
cgggagggcgcgcggctccagcggctgctacagggcctggtggggaagcgcagcgagcag
gacgcagagaacagcatggcctggaccaggctcagcgcgggtctgctctgcccgtcaggg
tccaacatgcccatcctgcaggcctggatgcccctggacgggacctggtctccctggctg
ccccctgggcctatggtttcagaaccagctggcgctgctgcagaaggaaccttgcggccc
agatga

DBGET integrated database retrieval system