KEGG   Homo sapiens (human): 6346
Entry
6346              CDS       T01001                                 

Gene name
CCL1, I-309, P500, SCYA1, SISe, TCA3
Definition
(RefSeq) C-C motif chemokine ligand 1
  KO
K05514  C-C motif chemokine 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N01215  CCL1 to CCR8 signaling
N01218  CCL1 to KSHV vGPCR signaling
N01219  CCL1 to YLDV 7L signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6346 (CCL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6346 (CCL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6346 (CCL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6346 (CCL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6346 (CCL1)
SSDB
Motif
Pfam: IL8 Lectin_leg-like
Other DBs
NCBI-GeneID: 6346
NCBI-ProteinID: NP_002972
OMIM: 182281
HGNC: 10609
Ensembl: ENSG00000108702
Vega: OTTHUMG00000132888
Pharos: P22362(Tbio)
UniProt: P22362
Position
17q12
AA seq 96 aa
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNE
GLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
NT seq 291 nt   +upstreamnt  +downstreamnt
atgcagatcatcaccacagccctggtgtgcttgctgctagctgggatgtggccggaagat
gtggacagcaagagcatgcaggtacccttctccagatgttgcttctcatttgcggagcaa
gagattcccctgagggcaatcctgtgttacagaaataccagctccatctgctccaatgag
ggcttaatattcaagctgaagagaggcaaagaggcctgcgccttggacacagttggatgg
gttcagaggcacagaaaaatgctgaggcactgcccgtcaaaaagaaaatga

DBGET integrated database retrieval system