KEGG   Homo sapiens (human): 6346Help
Entry
6346              CDS       T01001                                 

Gene name
CCL1, I-309, P500, SCYA1, SISe, TCA3
Definition
(RefSeq) C-C motif chemokine ligand 1
  KO
K05514  C-C motif chemokine 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Network
N00153  CXCR-GNB/G-PI3K-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6346 (CCL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6346 (CCL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6346 (CCL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6346 (CCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 Lectin_leg-like
Motif
Other DBs
NCBI-GeneID: 6346
NCBI-ProteinID: NP_002972
OMIM: 182281
HGNC: 10609
Ensembl: ENSG00000108702
Vega: OTTHUMG00000132888
Pharos: P22362(Tbio)
UniProt: P22362
Position
17q12
AA seq 96 aa AA seqDB search
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNE
GLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcatcaccacagccctggtgtgcttgctgctagctgggatgtggccggaagat
gtggacagcaagagcatgcaggtacccttctccagatgttgcttctcatttgcggagcaa
gagattcccctgagggcaatcctgtgttacagaaataccagctccatctgctccaatgag
ggcttaatattcaagctgaagagaggcaaagaggcctgcgccttggacacagttggatgg
gttcagaggcacagaaaaatgctgaggcactgcccgtcaaaaagaaaatga

DBGET integrated database retrieval system