KEGG   Homo sapiens (human): 6346
Entry
6346              CDS       T01001                                 

Gene name
CCL1, I-309, P500, SCYA1, SISe, TCA3
Definition
(RefSeq) C-C motif chemokine ligand 1
  KO
K05514  C-C motif chemokine 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N01215  CCL1 to CCR8 signaling
N01218  CCL1 to KSHV vGPCR signaling
N01219  CCL1 to YLDV 7L signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6346 (CCL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6346 (CCL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6346 (CCL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6346 (CCL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6346 (CCL1)
SSDB
Motif
Pfam: IL8 Lectin_leg-like
Other DBs
NCBI-GeneID: 6346
NCBI-ProteinID: NP_002972
OMIM: 182281
HGNC: 10609
Ensembl: ENSG00000108702
Vega: OTTHUMG00000132888
Pharos: P22362(Tbio)
UniProt: P22362
Position
17q12
AA seq 96 aa
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNE
GLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
NT seq 291 nt   +upstreamnt  +downstreamnt
atgcagatcatcaccacagccctggtgtgcttgctgctagctgggatgtggccggaagat
gtggacagcaagagcatgcaggtacccttctccagatgttgcttctcatttgcggagcaa
gagattcccctgagggcaatcctgtgttacagaaataccagctccatctgctccaatgag
ggcttaatattcaagctgaagagaggcaaagaggcctgcgccttggacacagttggatgg
gttcagaggcacagaaaaatgctgaggcactgcccgtcaaaaagaaaatga

KEGG   Homo sapiens (human): 6347
Entry
6347              CDS       T01001                                 

Gene name
CCL2, GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF
Definition
(RefSeq) C-C motif chemokine ligand 2
  KO
K14624  C-C motif chemokine 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05135  Yersinia infection
hsa05142  Chagas disease
hsa05144  Malaria
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05323  Rheumatoid arthritis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01174  VAV vCCI to CCR signaling
N01175  CCL2 to HCMV US28 signaling
N01176  CCL2 to HHV6 U12 signaling
N01177  CCL2 to HHV6 U51 signaling
Drug target
Bindarit: D03116
Carlumab: D09877
Pirfenidone: D01583<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6347 (CCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6347 (CCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6347 (CCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    6347 (CCL2)
   04657 IL-17 signaling pathway
    6347 (CCL2)
   04062 Chemokine signaling pathway
    6347 (CCL2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6347 (CCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6347 (CCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    6347 (CCL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    6347 (CCL2)
  09172 Infectious disease: viral
   05164 Influenza A
    6347 (CCL2)
   05168 Herpes simplex virus 1 infection
    6347 (CCL2)
   05163 Human cytomegalovirus infection
    6347 (CCL2)
  09174 Infectious disease: parasitic
   05144 Malaria
    6347 (CCL2)
   05142 Chagas disease
    6347 (CCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6347 (CCL2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6347 (CCL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6347 (CCL2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Chemokines
   6347 (CCL2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6347
NCBI-ProteinID: NP_002973
OMIM: 158105
HGNC: 10618
Ensembl: ENSG00000108691
Vega: OTTHUMG00000132887
Pharos: P13500(Tchem)
UniProt: P13500
Structure
PDB: 

Position
17q12
AA seq 99 aa
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaagtctctgccgcccttctgtgcctgctgctcatagcagccaccttcattccccaa
gggctcgctcagccagatgcaatcaatgccccagtcacctgctgttataacttcaccaat
aggaagatctcagtgcagaggctcgcgagctatagaagaatcaccagcagcaagtgtccc
aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag
aagtgggttcaggattccatggaccacctggacaagcaaacccaaactccgaagacttga

KEGG   Homo sapiens (human): 6348
Entry
6348              CDS       T01001                                 

Gene name
CCL3, G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3
Definition
(RefSeq) C-C motif chemokine ligand 3
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05142  Chagas disease
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01167  VAV vCCI to CCR signaling
N01168  CCL3/7 to HCMV US28 signaling
N01169  CCL3 to HHV6 U12 signaling
N01196  CCL3/4/5/8 to CCR5 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6348 (CCL3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6348 (CCL3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6348 (CCL3)
   04062 Chemokine signaling pathway
    6348 (CCL3)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6348 (CCL3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6348 (CCL3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    6348 (CCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6348 (CCL3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6348 (CCL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6348 (CCL3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Chemokines
   6348 (CCL3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6348
NCBI-ProteinID: NP_002974
OMIM: 182283
HGNC: 10627
Ensembl: ENSG00000277632
Vega: OTTHUMG00000188413
Pharos: P10147(Tbio)
UniProt: P10147 A0N0R1
Structure
PDB: 

Position
17q12
AA seq 92 aa
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
NT seq 279 nt   +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgctgtcctcctctgcaccatggctctctgcaaccag
ttctctgcatcacttgctgctgacacgccgaccgcctgctgcttcagctacacctcccgg
cagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaagccc
ggtgtcatcttcctaaccaagcgaagccggcaggtctgtgctgaccccagtgaggagtgg
gtccagaaatatgtcagcgacctggagctgagtgcctga

KEGG   Homo sapiens (human): 6351
Entry
6351              CDS       T01001                                 

Gene name
CCL4, ACT2, AT744.1, G-26, HC21, LAG-1, LAG1, MIP-1-beta, MIP1B, MIP1B1, SCYA2, SCYA4
Definition
(RefSeq) C-C motif chemokine ligand 4
  KO
K12964  C-C motif chemokine 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05163  Human cytomegalovirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N01196  CCL3/4/5/8 to CCR5 signaling
N01207  CCL4 to HHV6 U12 signaling
N01212  CCL4 to HCMV US28 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6351 (CCL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6351 (CCL4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6351 (CCL4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6351 (CCL4)
   04623 Cytosolic DNA-sensing pathway
    6351 (CCL4)
   04062 Chemokine signaling pathway
    6351 (CCL4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6351 (CCL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6351 (CCL4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6351 (CCL4)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6351
NCBI-ProteinID: NP_002975
OMIM: 182284
HGNC: 10630
Ensembl: ENSG00000275302
Vega: OTTHUMG00000188414
Pharos: P13236(Tbio)
UniProt: P13236
Structure
PDB: 

Position
17q12
AA seq 92 aa
MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRSKQVCADPSESWVQEYVYDLELN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcatgctagtagctgccttctgctctcca
gcgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaagaagcaagcaagtctgtgctgatcccagtgaatcc
tgggtccaggagtacgtgtatgacctggaactgaactga

KEGG   Homo sapiens (human): 3576
Entry
3576              CDS       T01001                                 

Gene name
CXCL8, GCP-1, GCP1, IL8, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1, SCYB8
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04218  Cellular senescence
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05219  Bladder cancer
hsa05323  Rheumatoid arthritis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
  Element
N00140  FUS-DDIT3 fusion to NFKB-mediated transcription
N00152  CXCR-GNB/G-ERK signaling pathway
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00544  HBV HBx to CREB-mediated transcription
N01233  CXCL1/5/6/8 to CXCR1 signaling
N01234  CXCL1/5/8 to KSHV vGPCR signaling
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    3576 (CXCL8)
   04072 Phospholipase D signaling pathway
    3576 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3576 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3576 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3576 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3576 (CXCL8)
   04621 NOD-like receptor signaling pathway
    3576 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    3576 (CXCL8)
   04657 IL-17 signaling pathway
    3576 (CXCL8)
   04062 Chemokine signaling pathway
    3576 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3576 (CXCL8)
   05202 Transcriptional misregulation in cancer
    3576 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    3576 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    3576 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    3576 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3576 (CXCL8)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3576 (CXCL8)
   05130 Pathogenic Escherichia coli infection
    3576 (CXCL8)
   05132 Salmonella infection
    3576 (CXCL8)
   05131 Shigellosis
    3576 (CXCL8)
   05135 Yersinia infection
    3576 (CXCL8)
   05133 Pertussis
    3576 (CXCL8)
   05134 Legionellosis
    3576 (CXCL8)
  09172 Infectious disease: viral
   05164 Influenza A
    3576 (CXCL8)
   05161 Hepatitis B
    3576 (CXCL8)
   05163 Human cytomegalovirus infection
    3576 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3576 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3576 (CXCL8)
   05144 Malaria
    3576 (CXCL8)
   05142 Chagas disease
    3576 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3576 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3576 (CXCL8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   3576 (CXCL8)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Chemokines
   3576 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 3576
NCBI-ProteinID: NP_000575
OMIM: 146930
HGNC: 6025
Ensembl: ENSG00000169429
Vega: OTTHUMG00000151316
Pharos: P10145(Tchem)
UniProt: P10145 A0A024RDA5
Structure
PDB: 

Position
4q13.3
AA seq 99 aa
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
NT seq 300 nt   +upstreamnt  +downstreamnt
atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacatac
tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgccaacacagaaattattgtaaagctttctgatggaagagagctctgtctggacccc
aaggaaaactgggtgcagagggttgtggagaagtttttgaagagggctgagaattcataa

DBGET integrated database retrieval system