KEGG   Homo sapiens (human): 6347Help
Entry
6347              CDS       T01001                                 

Gene name
CCL2, GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF
Definition
(RefSeq) C-C motif chemokine ligand 2
  KO
K14624  C-C motif chemokine 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05323  Rheumatoid arthritis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
Drug target
Bindarit: D03116
Carlumab: D09877
Pirfenidone: D01583
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6347 (CCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6347 (CCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6347 (CCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    6347 (CCL2)
   04657 IL-17 signaling pathway
    6347 (CCL2)
   04062 Chemokine signaling pathway
    6347 (CCL2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6347 (CCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6347 (CCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    6347 (CCL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    6347 (CCL2)
  09172 Infectious disease: viral
   05164 Influenza A
    6347 (CCL2)
   05168 Herpes simplex virus 1 infection
    6347 (CCL2)
   05163 Human cytomegalovirus infection
    6347 (CCL2)
  09174 Infectious disease: parasitic
   05144 Malaria
    6347 (CCL2)
   05142 Chagas disease (American trypanosomiasis)
    6347 (CCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6347 (CCL2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6347 (CCL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6347 (CCL2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Chemokines
   6347 (CCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6347
NCBI-ProteinID: NP_002973
OMIM: 158105
HGNC: 10618
Ensembl: ENSG00000108691
Vega: OTTHUMG00000132887
Pharos: P13500(Tchem)
UniProt: P13500
Structure
PDB: 

Position
17q12
AA seq 99 aa AA seqDB search
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctctgccgcccttctgtgcctgctgctcatagcagccaccttcattccccaa
gggctcgctcagccagatgcaatcaatgccccagtcacctgctgttataacttcaccaat
aggaagatctcagtgcagaggctcgcgagctatagaagaatcaccagcagcaagtgtccc
aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag
aagtgggttcaggattccatggaccacctggacaagcaaacccaaactccgaagacttga

DBGET integrated database retrieval system