KEGG   Homo sapiens (human): 6348Help
Entry
6348              CDS       T01001                                 

Gene name
CCL3, G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3
Definition
(RefSeq) C-C motif chemokine ligand 3
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
Network
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6348 (CCL3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6348 (CCL3)
   04062 Chemokine signaling pathway
    6348 (CCL3)
 09160 Human Diseases
  09162 Immune diseases
   05323 Rheumatoid arthritis
    6348 (CCL3)
  09167 Infectious diseases
   05132 Salmonella infection
    6348 (CCL3)
   05163 Human cytomegalovirus infection
    6348 (CCL3)
   05142 Chagas disease (American trypanosomiasis)
    6348 (CCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6348 (CCL3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6348 (CCL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6348 (CCL3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   6348 (CCL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6348
NCBI-ProteinID: NP_002974
OMIM: 182283
HGNC: 10627
Ensembl: ENSG00000277632
Vega: OTTHUMG00000188413
Pharos: P10147(Tbio)
UniProt: P10147 A0N0R1
Structure
PDB: 

Position
17q12
AA seq 92 aa AA seqDB search
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgctgtcctcctctgcaccatggctctctgcaaccag
ttctctgcatcacttgctgctgacacgccgaccgcctgctgcttcagctacacctcccgg
cagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaagccc
ggtgtcatcttcctaaccaagcgaagccggcaggtctgtgctgaccccagtgaggagtgg
gtccagaaatatgtcagcgacctggagctgagtgcctga

DBGET integrated database retrieval system