KEGG   Homo sapiens (human): 6352Help
Entry
6352              CDS       T01001                                 

Gene name
CCL5, D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP
Definition
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04668  TNF signaling pathway
hsa05020  Prion diseases
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05168  Herpes simplex infection
hsa05323  Rheumatoid arthritis
Network
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00429  HCMV UL22A to CCR5-GNB/G-PLCB/G-PKC signaling pathway
Disease
H01358  Atopic dermatitis
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6352 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6352 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6352 (CCL5)
   04621 NOD-like receptor signaling pathway
    6352 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    6352 (CCL5)
   04062 Chemokine signaling pathway
    6352 (CCL5)
 09160 Human Diseases
  09163 Immune diseases
   05323 Rheumatoid arthritis
    6352 (CCL5)
  09164 Neurodegenerative diseases
   05020 Prion diseases
    6352 (CCL5)
  09171 Infectious diseases: Bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6352 (CCL5)
  09172 Infectious diseases: Viral
   05164 Influenza A
    6352 (CCL5)
   05168 Herpes simplex infection
    6352 (CCL5)
   05163 Human cytomegalovirus infection
    6352 (CCL5)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    6352 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6352 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6352 (CCL5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6352 (CCL5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   6352 (CCL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6352
NCBI-ProteinID: NP_002976
OMIM: 187011
HGNC: 10632
Ensembl: ENSG00000271503
Vega: OTTHUMG00000188396
Pharos: P13501(Tchem)
UniProt: P13501 D0EI67
Structure
PDB: 

Position
17q12
AA seq 91 aa AA seqDB search
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgcggcagccctcgctgtcatcctcattgctactgccctctgcgctcct
gcatctgcctccccatattcctcggacaccacaccctgctgctttgcctacattgcccgc
ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca
gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctag

DBGET integrated database retrieval system