KEGG   Homo sapiens (human): 6355
Entry
6355              CDS       T01001                                 

Gene name
CCL8, HC14, MCP-2, MCP2, SCYA10, SCYA8
Definition
(RefSeq) C-C motif chemokine ligand 8
  KO
K16596  C-C motif chemokine 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01196  CCL3/4/5/8 to CCR5 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6355 (CCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6355 (CCL8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6355 (CCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6355 (CCL8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6355 (CCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6355
NCBI-ProteinID: NP_005614
OMIM: 602283
HGNC: 10635
Ensembl: ENSG00000108700
Vega: OTTHUMG00000132883
Pharos: P80075(Tbio)
UniProt: P80075
Structure
PDB: 
1ESR

Position
17q12
AA seq 99 aa
MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtttctgcagcgcttctgtgcctgctgctcatggcagccactttcagccctcag
ggacttgctcagccagattcagtttccattccaatcacctgctgctttaacgtgatcaat
aggaaaattcctatccagaggctggagagctacacaagaatcaccaacatccaatgtccc
aaggaagctgtgatcttcaagaccaaacggggcaaggaggtctgtgctgaccccaaggag
agatgggtcagggattccatgaagcatctggaccaaatatttcaaaatctgaagccatga

DBGET integrated database retrieval system